Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR175 IGR179 IGR178 IGR177 IGR176 IGR180 IGR174 IGR172 IGR173 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0216 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208
* Calculated from Protein Sequence

Gene ID: CPn0211

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
252756

Gene Stop:
252460

Gene Length:
297

Molecular Weight*:
10263

pI*:
8.40

Net Charge*:
1.41

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to a known sequence in any other organisms.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0211 is weakly similar to CPn0215 and CPn0212, both hypothetical proteins. Residues 38-97 are 38% similar to CPn0215 and residues 37-90 are 38% similar to CPn0212.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
39  
58
transmembrane  
63  
84

PDB Hit:


Gene Protein Sequence:
MSYPDISNVQASSIQSALLHKTSDQIQQKRCFKQSTFVILAVSLVIIGSL
FLLAGVAILTVFSHGVLSLVFGVLGIVLGLLLLAGGVGLLVEEAKSLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTATCCTGATATTTCCAATGTACAGGCCTCTTCTATTCAATCTGC
TTTGCTTCATAAGACTTCTGACCAGATACAACAGAAGAGGTGCTTTAAAC
AAAGTACTTTTGTGATCTTAGCTGTGAGCTTAGTTATTATAGGTTCTCTT
TTTCTTCTTGCTGGGGTTGCCATACTCACAGTATTTTCTCATGGAGTCCT
TTCATTAGTTTTTGGGGTTCTTGGGATTGTTCTGGGACTTCTTTTATTAG
CTGGAGGAGTCGGACTTTTAGTTGAGGAAGCAAAATCTTTATTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy