Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR171 IGR175 IGR170 IGR179 IGR178 IGR177 IGR176 IGR174 IGR172 IGR173 CPn0213 CPn0211 CPn0210 CPn0212 CPn0214 CPn0215 CPn0205 CPn0209 CPn0206 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0210 CPn0212 CPn0214 CPn0215 CPn0205 CPn0209 CPn0206 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0210 CPn0212 CPn0214 CPn0215 CPn0209 CPn0206 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0205
* Calculated from Protein Sequence

Gene ID: CPn0209

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
251036

Gene Stop:
251275

Gene Length:
240

Molecular Weight*:
9179

pI*:
10.70

Net Charge*:
5.22

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18362. Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several probable paralogs in C.pneumoniae, all of which are predicted hypothetical proteins.

Residues 1-65 are 48% similar to residues 1-66 of CPn0203.
Residues 1-65 are 39% similar to residues 1-66 of CPn0157.
Residues 1-65 are 33% similar to residues 1-66 of CPn0977.
Residues 1-65 are 37% similar to residues 1-67 of CPn0162.
Residues 1-65 are 32% similar to residues 1-65 of CPn0978.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
40  
57

PDB Hit:


Gene Protein Sequence:
METYSFSTELQKNTSLYIMEKLDSYFSFQGKRTRVIAITPAGLAIAYEQN
IHLSMTVKILKVLSFPRSLLRTTSLWYRP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAACTTATAGCTTTTCTACAGAACTACAGAAAAATACTTCTCTCTA
TATCATGGAAAAGTTAGATTCCTATTTTTCCTTTCAAGGCAAACGCACAC
GGGTAATTGCAATAACCCCTGCAGGTTTAGCCATCGCCTACGAGCAGAAT
ATCCACCTCTCTATGACCGTGAAAATATTAAAAGTCCTCTCCTTTCCACG
GTCTCTCCTCAGGACAACTAGTTTGTGGTATCGCCCTTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy