Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR171 IGR175 IGR170 IGR178 IGR177 IGR169 IGR176 IGR174 IGR172 IGR173 IGR167 CPn0213 CPn0211 CPn0210 CPn0212 CPn0214 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0213 CPn0211 CPn0210 CPn0212 CPn0214 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0211 CPn0210 CPn0212 CPn0214 CPn0213 CPn0209 CPn0206 CPn0203 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0208

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pfpA  pfkA_1  

Definition:
fructose-6-P phosphotransferase

Gene Start:
248953

Gene Stop:
250605

Gene Length:
1653

Molecular Weight*:
61170

pI*:
7.40

Net Charge*:
3.46

EC:
2.7.1.11  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Fructose and mannose metabolism
Galactose metabolism
Glycolysis / Gluconeogenesis
Pentose phosphate cycle

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Fructose-6-P Phosphotransferase sequences; e.g. residues 16-550 are 62% similar to (AE001294) Fructose-6-P Phosphotransferase (CT205); residues 45-531 are 38% similar to (TP0542) pyrophosphate--fructose 6-phosphate 1-phosphotransferase, beta subunit [Treponema pallidum]; residues 15-512 are 37% similar to (AJ224475) pyrophosphate-fructose 6-phosphate 1-phosphotransferase [Borrelia burgdorferi]; and residues 45-516 are 38% similar to PFPB_SOLTU. Also weak similarity to MG215, a predicted 6-phosphofructokinase. No significant similarity to U.ureaplasma.


COGS Summary:  COGS Search
BeTs to 9 clades of COG0205
COG name: 6-phosphofructokinase
Functional Class: G
The phylogenetic pattern of COG0205 is ----YqVCebrh--gpOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 71-428 span five regions of similarity to blocks BL00433A-D (Phosphofructokinase proteins).

ProDom Summary:  Protein Domain Search
Residues 73-322 are 50% similar to a defined domain of O51052_BORBU, defined as: 6-PHOSPHOFRUCTOKINASE TRANSFERASE PHOSPHOFRUCTOKINASE KINASE PHOSPHOHEXOKINASE GLYCOLYSIS REPEAT ALLOSTERIC ENZYME ISOZYME.

Residues 338-452 are 43% similar to a defined domain of PFPB_RICCO.

Paralogs:  Local Blast Search
CPn0160, a predicted Fructose-6-P Phosphotransferase sequence, is a probable paralog. Residues 32-530 are 40% similar.

Pfam Summary:  Pfam Search
Residues 72 to 360 (E-value = 1.8e-10) place CPn0208 in the PFK family which is described as Phosphofructokinase (PF00365)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
268  
359

PDB Hit:


Gene Protein Sequence:
MHPLYVDLDTIISSYSPPLPKEFQEAASLIAVPDTSHSKPVVPGVKTLFP
QTYHLPYLKFVQGENVVHTPLKVGVMFSGGPAPGGHNVIQGLFNSLKDFH
PDSSLVGFVNNGDGLTNNKSIDITEEFLSKFRNSGGFNCIGTGRKKIVTP
EAKEACLKTAEALDLDGLVIIGGDGSNTATAILAEYFAKRRPKTSIVGVP
KTIDGDLQHTFLDLTFGFDTATKFYSSIISNISRDALSCKAHYHFIKLMG
RSASHIALECALQTHPNIALIGEEIAEKNLPLKTIIHKICSVIADRAAME
KYYGVILIPEGIIEFIPEIINLITEIESLSEYEDKISRLSPESQRLLKSF
PAPIIEQILNDRDAHGNVYVSKISVDKLLIHLVSNHLQQYFPNVPFNAIS
HFLGYEGRSGLPTKFDNTYGYSLGYGAGILVRNHCNGYLSTIESLACPFM
KWKLRAIPVVKMFTVKQQADGTLQPKIKKYLVDIGSTAFRKFKLYRKIWA
LEDSYRFLGPLQIETPPEMHSDNFPPLTLLLNHNFWQRHQGCIEIPDTTY
$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCCTTTATACGTTGATCTTGATACTATTATCAGCTCCTACTCTCC
TCCCTTACCTAAAGAATTTCAAGAAGCAGCCTCTTTAATTGCTGTTCCAG
ATACTTCACATTCTAAGCCTGTCGTTCCAGGAGTGAAAACCCTCTTTCCA
CAAACCTACCACCTTCCCTATCTAAAGTTTGTCCAAGGAGAAAATGTCGT
TCACACTCCTCTAAAAGTAGGCGTAATGTTCTCAGGAGGACCTGCTCCAG
GAGGACATAATGTCATCCAAGGACTCTTCAATAGTCTAAAAGATTTCCAT
CCCGATTCCTCCCTCGTGGGGTTCGTAAATAATGGAGACGGTCTTACAAA
CAATAAAAGCATAGACATTACTGAAGAGTTTCTCTCCAAATTCCGAAATT
CCGGAGGCTTCAACTGTATAGGAACAGGAAGGAAAAAAATTGTAACTCCA
GAAGCTAAAGAGGCTTGTCTAAAGACCGCAGAGGCTCTGGATCTCGACGG
ACTAGTCATTATTGGCGGTGATGGCTCCAATACAGCAACCGCTATTCTTG
CAGAGTATTTTGCAAAACGACGCCCAAAAACCTCTATTGTCGGAGTTCCT
AAAACTATAGATGGGGATCTACAACACACCTTCTTGGATCTGACCTTCGG
ATTTGATACTGCAACAAAATTCTACTCTTCAATCATTAGCAATATTTCAA
GAGATGCTCTTTCCTGTAAAGCTCATTACCACTTCATTAAACTTATGGGA
CGCTCAGCATCCCATATTGCTTTGGAATGTGCTCTCCAAACTCATCCAAA
TATTGCCCTTATCGGCGAAGAAATTGCCGAAAAAAATCTACCACTAAAAA
CCATCATCCATAAAATCTGCTCCGTAATTGCAGATAGAGCCGCTATGGAA
AAATACTATGGCGTCATCCTCATCCCAGAAGGCATTATCGAGTTCATCCC
AGAAATCATCAACTTAATTACAGAAATCGAAAGCCTATCAGAATACGAAG
ATAAAATCTCCAGGCTCTCTCCAGAATCCCAACGCCTACTGAAAAGCTTC
CCAGCACCTATCATCGAGCAAATCCTCAATGACCGCGATGCTCACGGTAA
TGTCTATGTTTCTAAAATTAGTGTCGATAAACTACTCATCCACCTGGTCA
GCAATCATCTCCAACAATATTTCCCTAACGTCCCTTTCAATGCGATCTCA
CATTTTCTAGGATATGAAGGACGCTCGGGATTGCCTACAAAATTCGATAA
TACCTACGGCTATAGCCTCGGATACGGCGCCGGTATTCTCGTCCGCAATC
ACTGCAACGGCTATCTCTCTACTATAGAATCCCTAGCATGCCCTTTCATG
AAATGGAAATTACGGGCAATTCCCGTAGTGAAAATGTTCACAGTAAAACA
ACAGGCAGATGGAACTCTACAACCTAAAATTAAAAAATACCTCGTAGATA
TAGGAAGCACGGCATTTCGTAAATTTAAGCTCTATAGGAAAATTTGGGCC
CTCGAAGACTCCTACCGATTCCTAGGGCCTCTACAAATAGAAACTCCTCC
AGAAATGCACTCTGATAATTTCCCTCCTCTTACCCTTTTGCTTAATCATA
ACTTTTGGCAACGTCACCAGGGTTGCATAGAAATCCCTGATACTACGTAT
TAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy