Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR171 IGR175 IGR170 IGR169 IGR176 IGR174 IGR172 IGR173 IGR167 CPn0211 CPn0210 CPn0212 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0211 CPn0210 CPn0212 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0212 CPn0210 CPn0211 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 oppF, - CPn0202 oppF, - CPn0202 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0207

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ybhI  

Definition:
oxoglutarate/malate translocator protein

Gene Start:
247208

Gene Stop:
248620

Gene Length:
1413

Molecular Weight*:
50776

pI*:
10.20

Net Charge*:
9.63

EC:
 

Functional Class:
transport and binding proteins;  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to translocator protein sequences; e.g. residues 1-470 are 77% similar to CT204; residues 20-469 are 52% similar to (D86417) YflS [Bacillus subtilis]; residues 20-469 are 50% similar to SOT1_SPIOL; and residues 20-467 are 33% similar to YBHI_ECOLI.
No significant similarity to M.genitalium, U.urealyticum, or T.pallidum.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0471
COG name: Cation transporters
Functional Class:  P
The phylogenetic pattern of COG0471 is -MtkYq-cEb-HuJ----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 10-156 are 55% similar to a defined domain of O34726_BACSU, defined as: PROTEIN TRANSMEMBRANE INNER MEMBRANE TRANSPORT CITRATE CARRIER TRANSPORTER ANTIPORTER TARTRATE.
Residues 38-155 are 57% similar to a defined domain of SOT1_SPIOL, defined as: PROTEIN TRANSMEMBRANE TRANSPORT MEMBRANE ARSENICAL COTRANSPORTER INNER TRANSPORTER PUMP RESISTANCE.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 470 (E-value = 1.1e-276) place CPn0207 in the Na_sulph_symp family which is described as Sodium:sulfate symporter transmembrane region (PF00939)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
29
non-globular  
32  
105
non-globular  
263  
436

PDB Hit:


Gene Protein Sequence:
VNKKKRFLSLLFLTAVLLGIWFSPHPASINSNAWQLFAIFTTTIMGIIFQ
PVPMGAIAIIGISTLLLTQTLTLEQGLSGFHNPIAWLVFLSFSIAKGIIK
TGLGERIAYFFVSALGKSPLGLSYGLVITDFFLAPAIPSVTARAGGILYP
VVTSLSDSFGSSAEKGTQDLIGSFLIKVAYQSSVITSAMFLTAMAGNPLV
AALAGHVGVSLSWVLWAKAAIIPGLPSLFLMPIILYKLYPPKITSCEEAI
RSAKLRLKEMGPLKKEEKTILMIFFLLVVLWTFGDLLGISATTAALIGLS
LLILTNILDWQKDVIANTTAWETFIWFGALIMMASFLNQLGFIPLVGDSA
AALVSGLSWKIGFPLLFLIYFYSHYLFASNTAHIGAMYPIFLAVSISLGT
NPIFAALTLAFASNLFGGLTHYGSGPAPLYFGSHLVTVQEWWRSGFALSI
VNIVIWIGIGSLWWKALGLI$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAACAAAAAAAAACGTTTCTTATCTCTCCTCTTTCTGACTGCAGTACT
TTTAGGCATTTGGTTCTCTCCCCATCCCGCATCTATAAATTCTAATGCTT
GGCAACTCTTCGCTATATTCACAACTACTATCATGGGAATCATTTTCCAG
CCCGTCCCCATGGGAGCTATTGCCATTATTGGAATCTCCACACTACTACT
CACACAAACGTTAACTCTAGAACAAGGATTGTCAGGATTCCATAATCCTA
TAGCGTGGTTAGTCTTCCTCTCCTTCTCAATAGCAAAAGGAATCATAAAA
ACAGGACTCGGTGAACGAATCGCATACTTCTTTGTCAGTGCTTTGGGGAA
AAGTCCTCTAGGACTCAGCTATGGACTGGTAATCACAGATTTTTTCCTTG
CACCTGCAATCCCCAGCGTGACTGCTCGAGCTGGAGGGATTCTCTATCCC
GTAGTCACGAGCTTATCAGATTCCTTTGGAAGTTCCGCAGAAAAAGGAAC
TCAAGATCTTATCGGATCCTTCCTCATTAAAGTTGCCTATCAAAGCTCAG
TGATCACCAGCGCTATGTTCCTCACTGCTATGGCAGGAAACCCTCTGGTG
GCAGCTCTAGCAGGCCACGTCGGGGTTTCTTTATCTTGGGTTCTATGGGC
AAAAGCCGCAATCATTCCAGGACTCCCCAGTCTATTCCTCATGCCGATCA
TACTCTACAAACTCTACCCACCAAAAATCACATCTTGTGAAGAGGCTATC
CGATCGGCAAAACTTCGACTCAAAGAAATGGGGCCGCTAAAAAAAGAAGA
AAAAACAATATTGATGATCTTTTTCCTCCTTGTAGTCCTCTGGACTTTTG
GAGATCTCTTAGGAATCTCAGCAACAACAGCAGCCCTTATAGGACTGTCT
CTCCTCATCCTCACTAATATTCTAGATTGGCAAAAAGATGTCATAGCAAA
TACAACAGCATGGGAAACATTCATCTGGTTCGGAGCCTTAATCATGATGG
CTTCCTTCTTAAACCAACTCGGGTTTATCCCACTCGTAGGAGACTCAGCA
GCAGCACTGGTCAGTGGCCTCTCTTGGAAAATTGGCTTCCCTCTACTCTT
CCTGATCTACTTCTACTCCCACTACCTTTTTGCTAGCAATACCGCGCATA
TCGGAGCCATGTATCCCATATTCCTCGCAGTCTCCATATCGTTAGGGACT
AATCCTATATTCGCAGCACTCACCCTAGCATTCGCAAGCAACCTTTTTGG
AGGACTCACTCATTACGGATCCGGACCCGCACCCCTCTACTTCGGGTCAC
ATCTCGTTACTGTCCAAGAGTGGTGGCGGTCAGGATTCGCTCTTAGCATT
GTCAATATTGTTATCTGGATAGGAATCGGAAGCTTGTGGTGGAAAGCCCT
CGGACTCATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy