Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR170 IGR169 IGR174 IGR172 IGR173 IGR167 CPn0210 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 oppB_1, - CPn0199 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0210 CPn0204 CPn0205 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 oppB_1, - CPn0199 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0210 CPn0209 CPn0206 CPn0203 oppD, - CPn0201 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 oppF, - CPn0202 oppC_1, - CPn0200 oppF, - CPn0202 oppB_1, - CPn0199 CPn0205 oppC_1, - CPn0200 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0206

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
246409

Gene Stop:
247164

Gene Length:
756

Molecular Weight*:
28250

pI*:
4.30

Net Charge*:
-22.48

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0206 is orthologously related to CT203, a hypothetical protein (acidic): residues
1-250 are 75% similar to CT203.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 251 (E-value = 3.6e-197) place CPn0206 in the DUF1186 family which is described as Protein of unknown function (DUF1186) (PF06685)

PDB Hit:


Gene Protein Sequence:
LLMDISHILEDLAYDEGILPREAIEAAIVKQMQITPYLLHILHDATQRVP
EIVNDGSYQGHLYAMYLLAQFRESRALPLIIKLFAFEDDTPHAIAGDVLT
EDLPRILASVCNDDSLIKELIETPKINPYVKAAAISGLVTLVGAGKIPRD
KVIRYFAELLNYRLEKQPSFAWDNLIAGICTLYPGELFYPISKAFDGGLV
DTSFISMEDVENIIHEETVESCIHTLCSSTELINDTLEEMEKWLEDFPIE
P$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTAATGGATATTTCCCATATCCTGGAAGATCTTGCCTATGACGAAGG
GATCCTTCCAAGGGAAGCTATAGAAGCGGCTATTGTTAAACAAATGCAAA
TTACGCCTTATTTACTGCATATTTTACACGACGCTACTCAGCGCGTCCCT
GAGATTGTAAATGATGGGAGTTATCAAGGTCACCTCTATGCCATGTATCT
CCTCGCACAATTCAGAGAAAGTCGCGCACTCCCTCTCATCATTAAACTCT
TTGCATTTGAAGATGATACTCCACACGCAATAGCAGGTGATGTCCTAACC
GAAGATCTGCCTAGGATCCTAGCTAGCGTCTGCAATGATGACTCGCTAAT
TAAAGAGCTCATAGAAACTCCAAAAATCAATCCTTATGTGAAGGCAGCCG
CAATCTCTGGTCTTGTAACTCTTGTAGGAGCCGGGAAAATTCCTAGGGAT
AAAGTTATCCGTTATTTTGCAGAACTTCTAAACTATAGATTAGAAAAACA
GCCCTCGTTCGCTTGGGATAACCTAATCGCAGGGATCTGTACTCTTTACC
CCGGAGAGCTCTTCTATCCAATAAGCAAAGCCTTTGACGGAGGACTTGTT
GATACATCTTTCATCAGCATGGAAGATGTCGAAAATATTATCCACGAAGA
AACCGTGGAATCTTGTATCCATACCCTCTGTTCTTCTACAGAACTCATTA
ATGACACTCTAGAAGAAATGGAAAAATGGTTAGAAGACTTCCCCATAGAA
CCGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy