Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR170 IGR169 IGR172 IGR173 IGR167 CPn0204 CPn0205 CPn0209 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0204 CPn0205 CPn0209 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 CPn0209 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 pfpA,pfkA_1, - CPn0208 oppD, - CPn0201 oppD, - CPn0201 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0205

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
246133

Gene Stop:
246330

Gene Length:
198

Molecular Weight*:
7503

pI*:
8.80

Net Charge*:
3.32

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LLKFFLVCEELCILTVATHRALLETPLALSFFKELKTKYVYRAKDILQLH
NYKGFTILNTSPLCS$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTAAAGTTCTTTCTAGTATGTGAAGAGTTATGTATACTTACTGTTGC
TACACATAGAGCTCTCTTAGAAACTCCTTTAGCTCTATCATTTTTTAAAG
AACTTAAGACAAAATATGTCTACAGGGCGAAAGACATACTACAACTACAT
AACTATAAAGGATTTACTATCCTTAATACATCACCGTTATGTTCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy