Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR170 IGR169 IGR165 IGR172 IGR167 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 oppD, - CPn0201 oppD, - CPn0201 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0203

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
245008

Gene Stop:
245805

Gene Length:
798

Molecular Weight*:
30467

pI*:
9.90

Net Charge*:
9.26

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 166-236 are 43% similar to residues 6-74 of Q46223_CHLPS.

Paralogs:  Local Blast Search
Several significant hits to C.pneumoniae sequences show probable paralogy to hypothetical proteins. In order, they are: CPn0157, CPn0162, CPn0159, CPn0977, CPn0976, CPn0978, CPn0209, and CPn0158.

Residues 1-138 are 43% similar to residues 1-142 of CPn0157.
Residues 1-234 are 29% similar to residues 1-255 of CPn0162.

Pfam Summary:  Pfam Search
Residues 1 to 265 (E-value = 1.6e-07) place CPn0203 in the DUF648 family which is described as Family of unknown function (DUF648) (PF04890)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
61  
78
transmembrane  
144  
161

PDB Hit:


Gene Protein Sequence:
MNTYTFSPTLQKSFSLFLLEKLDSYFFFGGTRTQILVITPTNIRLAAKKR
GCKVSTIEKIIKILSFILLPLVIIAFILRYFLHKKFDKQFLCIPKVISNE
DEALLGSRPQAVEKAVREISPAFFSIPRKYQLIRIDTPKDDAPSILFPIG
IEIILKDLCIDTLKQSNLFLKREMDFLGHPEEKALFDSICSIEKDQEWMS
LESKKLLITHFLKYLFVSGIEQLNPGFNPENGRGYFSEISTAKIHFHQHG
RYGPIRSSGPIMKEI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATACCTATACCTTCTCTCCTACACTTCAGAAAAGCTTCAGCCTATT
TCTTTTAGAAAAATTAGACTCTTACTTTTTCTTTGGAGGGACTCGTACAC
AAATCTTAGTCATCACACCAACCAATATTAGATTAGCAGCTAAAAAAAGA
GGGTGTAAGGTTTCTACTATAGAAAAGATAATCAAGATCCTCTCTTTTAT
CCTGCTGCCCCTAGTTATCATTGCCTTTATACTTCGCTATTTCTTACATA
AGAAATTCGATAAACAGTTCTTGTGTATCCCAAAAGTCATTTCTAACGAA
GACGAAGCTCTTCTTGGATCTAGACCACAAGCAGTTGAAAAAGCAGTTCG
AGAAATATCTCCAGCCTTCTTCTCTATACCAAGAAAATACCAACTTATTA
GAATCGACACTCCTAAAGATGACGCTCCCTCAATCCTTTTCCCTATAGGC
ATAGAGATCATTCTCAAAGATTTATGTATTGATACACTCAAGCAATCTAA
TCTTTTCCTTAAAAGAGAAATGGATTTCTTAGGTCATCCAGAAGAAAAAG
CATTATTCGACTCGATATGTTCTATAGAAAAAGATCAAGAATGGATGAGC
TTGGAAAGTAAAAAACTTTTAATCACGCACTTCCTAAAGTATCTCTTTGT
CTCTGGAATCGAACAACTAAATCCAGGCTTTAACCCAGAGAATGGGCGTG
GGTATTTTTCAGAAATAAGTACAGCAAAGATCCATTTTCATCAGCACGGT
CGATATGGGCCAATCCGTTCTTCGGGACCCATCATGAAGGAAATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy