Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR170 IGR169 IGR164 IGR165 IGR172 IGR167 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 pfpA,pfkA_1, - CPn0208 oppD, - CPn0201 oppD, - CPn0201 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0202

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppF  

Definition:
oligopeptide ABC transporter protein

Gene Start:
243715

Gene Stop:
244503

Gene Length:
789

Molecular Weight*:
29065

pI*:
7.50

Net Charge*:
1.30

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0202 is most similar to CT202, a predicted oppF oligopeptide ABC transporter protein:
residues 1-243 are 64% similar to CT202.
Numerous significant hits in gapped BLAST to oligopeptide ABC transporter sequences; e.g. residues 18-240 are 41% similar to (AL022121) dppD [Mycobacterium tuberculosis]; residues 23-240 are 38% similar to OPPF_LACLA; and residues 18-240 are 37% similar to (AE001692) oligopeptide ABC transporter, ATP-binding protein [Thermotoga maritima].

COGS Summary:  COGS Search
BeTs to 10 clades of COG1124
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class:  E,P
The phylogenetic pattern of COG1124 is a-TK-qV-EB-HujGPo-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 35-46 and 136-167 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 2.7e-25.

ProDom Summary:  Protein Domain Search
Residues 135-177 are 62% similar to a defined domain of O69631_MYCTU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Residues 85-242 are 27% similar to a defined domain of O34159_SALTY, defined as: PUTATIVE ATPASE.

Paralogs:  Local Blast Search
Numerous probable paralogs exist, the most similar of which are: CPn0201, CPn0683, CPn0682, CPn0280, and CPn0542. Residues 4-239 are 34% similar to CPn0201.

Pfam Summary:  Pfam Search
Residues 30 to 212 (E-value = 1.2e-54) place CPn0202 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
62

PDB Hit:


Gene Protein Sequence:
MTTLLSIKDLSLTIRGKKILNHINLNLIKGSYLTIVGPSGSGKSSLALTI
LDLLKPTTGTITFHMDPKIPRARKVQVIWQDIDSSLNPCMSIKGIISEPL
NIIGTYSKAEQNKEIYNVLDLVNLPKSVLHLKPYKLSGGQKQRIAIAKAL
VSKPELLICDEPLSSLDTLNQSLILDLFQTIKKEYQNTLLFITHDMSAAY
YIADTIAVMDQGSLVEHACREKIFSTPKHTTTQDLLDAIPIFSLISTEME
PSEEYELQVASK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAACTCTACTAAGTATAAAGGACCTTTCCCTAACCATCAGAGGAAA
GAAAATTCTTAATCATATTAACCTCAACCTAATCAAAGGAAGCTACTTAA
CAATCGTAGGACCCAGTGGCTCAGGAAAATCTTCCTTAGCACTTACTATT
CTGGATCTCCTAAAACCTACCACAGGAACAATCACGTTTCATATGGACCC
CAAGATCCCCAGAGCACGTAAGGTCCAAGTGATCTGGCAGGATATCGACT
CGAGTCTAAATCCCTGCATGTCTATAAAAGGAATTATTTCCGAACCCCTA
AATATCATCGGAACCTATTCTAAAGCCGAACAAAATAAAGAGATTTATAA
CGTTCTTGATCTTGTGAACCTCCCCAAGTCTGTTCTCCACCTTAAGCCTT
ATAAACTCAGTGGAGGACAAAAACAACGCATAGCCATTGCAAAAGCTCTA
GTCTCAAAACCCGAGCTCCTTATCTGTGATGAACCCCTCTCCTCACTAGA
CACGCTCAACCAATCCCTAATCTTAGACCTTTTTCAAACAATAAAAAAAG
AATACCAAAATACCCTTCTCTTTATCACCCACGATATGTCCGCAGCGTAT
TATATTGCAGACACTATCGCCGTCATGGATCAAGGAAGTCTTGTCGAACA
TGCTTGTAGAGAAAAAATTTTCTCAACTCCCAAGCATACAACTACACAAG
ATCTTCTCGACGCCATCCCCATATTTTCCTTGATCTCCACAGAAATGGAA
CCCTCGGAAGAATACGAATTACAAGTCGCCTCAAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy