Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR170 IGR169 IGR164 IGR165 IGR167 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 ybhI, - CPn0207 oppA_4, - CPn0198 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 ybhI, - CPn0207 oppA_4, - CPn0198 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 ybhI, - CPn0207 oppA_4, - CPn0198 oppD, - CPn0201 oppD, - CPn0201 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0201

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppD  

Definition:
oligopeptide ABC transporter

Gene Start:
242864

Gene Stop:
243718

Gene Length:
855

Molecular Weight*:
31660

pI*:
10.20

Net Charge*:
12.01

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLASt to oligopeptide transport ATPase sequences; e.g. residues 1-268 are 55% similar to CT201; residues 8-260 are 38% similar to UU560; residues 2-282 are 33% similar to MG079; residues 5-254 are 35% similar to CT690; residues 2-260 are 45% similar to (X89237) oligopeptidepermease [Streptococcus pyogenes]; residues 5-257 are 45% similar to (AF000366) oligopeptide permease homolog D [Borrelia burgdorferi]; and residues 5-254 are 45% similar to OPPD_BACSU.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0444
COG name: ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component
Functional Class:  E,P
The phylogenetic pattern of COG0444 is a-TKyqV-EB-Hujgpo-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 38-49 and 154-185 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 4.3e-24.

ProDom Summary:  Protein Domain Search
Residues 153-196 are 70% similar to a defined domain of OPPD_BACSU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Resdiues 81-151 are 46% similar to a defined domain of Q54910_STRPY, defined as: TRANSPORT ATP-BINDING PROTEIN PEPTIDE OLIGOPEPTIDE MEMBRANE ABC TRANSPORTER INNER DIPEPTIDE.

Paralogs:  Local Blast Search
Numerous probable paralogs exist, the most similar of which are: CPn0682, CPn0683, CPn0202, CPn0280, and CPn0248. Residues 3-254 are 36% similar to CPn0682.

Pfam Summary:  Pfam Search
Residues 33 to 230 (E-value = 5.4e-50) place CPn0201 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
36

PDB Hit:


Gene Protein Sequence:
MDNYLLNIKDLTITSTNPKRTLIENLSLQLKENRNLALVGESGSGKTTIT
KAILGFLPENCLIKTGSILFEDIDITKLSPKELHKIRGQKIATILQNAMG
SLTPSMRIGMQIIETLRQHHKMNKEEAYNKAMQLLTDVCIPNPKYSFSQY
PFELSGGMRQRVVIAIALASQPKLILADEPTTALDSMSQAQVLRILRNIQ
QQKQATILLVTHNLSLVKELCNDICIIKDGKLIETGTVEEIFLSPKHPYT
LKLLNAVSKIPIKKTSSPILKNKFQPLMSMQGGL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATAACTACTTACTAAATATCAAGGATCTCACAATAACCTCTACAAA
CCCTAAGAGAACTCTAATTGAAAATTTATCACTACAGCTCAAAGAAAATC
GAAATCTTGCTCTAGTCGGAGAGAGCGGCTCAGGGAAAACTACAATTACC
AAAGCCATCCTAGGCTTCCTCCCCGAAAATTGTCTGATCAAAACCGGAAG
TATTTTATTTGAAGATATAGATATTACCAAGCTCTCACCAAAAGAGCTCC
ATAAGATCCGCGGTCAAAAGATCGCCACAATACTACAAAATGCTATGGGT
TCTCTAACCCCATCCATGCGCATAGGAATGCAAATCATAGAAACCTTAAG
ACAACACCACAAAATGAATAAAGAGGAAGCCTATAATAAAGCTATGCAAC
TCCTTACCGATGTTTGCATTCCTAATCCAAAATATAGCTTCTCACAATAC
CCCTTTGAATTGAGTGGTGGCATGCGCCAACGTGTTGTAATCGCCATAGC
ACTCGCAAGCCAACCTAAGCTCATTCTTGCCGATGAACCTACAACAGCCC
TAGACTCTATGTCACAAGCTCAAGTCCTTAGGATTCTTCGTAATATCCAA
CAACAGAAACAAGCTACAATCCTTCTTGTTACCCATAACCTCTCTCTAGT
CAAAGAGCTCTGTAATGATATCTGTATTATCAAAGACGGCAAACTCATAG
AAACAGGAACCGTTGAAGAGATTTTCCTCTCTCCGAAACACCCCTATACT
CTCAAGCTCCTCAATGCTGTCTCTAAAATCCCTATTAAAAAAACCAGCTC
TCCCATCCTTAAAAATAAGTTCCAACCTCTAATGAGTATGCAAGGTGGTT
TATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy