Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR171 IGR163 IGR170 IGR169 IGR164 IGR165 IGR167 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 ybhI, - CPn0207 oppA_4, - CPn0198 oppA_2, - CPn0196 CPn0204 CPn0205 CPn0206 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 ybhI, - CPn0207 oppA_4, - CPn0198 oppA_2, - CPn0196 CPn0205 oppF, - CPn0202 CPn0203 oppC_1, - CPn0200 oppB_1, - CPn0199 ybhI, - CPn0207 oppA_4, - CPn0198 oppA_2, - CPn0196 oppD, - CPn0201 oppD, - CPn0201 CPn0204 CPn0206 oppA_3, - CPn0197
* Calculated from Protein Sequence

Gene ID: CPn0200

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppC_1  

Definition:
dipeptide ABC transporter

Gene Start:
242017

Gene Stop:
242871

Gene Length:
855

Molecular Weight*:
31473

pI*:
10.00

Net Charge*:
8.24

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
The APPC protein is part of the oligopeptide permease systems and can substitute for the OPP systems, however it is said to be unable to transport tripeptides. In B. subtilis, this protein supports sporulation.

From Prosite PDOC00364:

Bacterial binding protein-dependent transport systems are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system.

The integral inner-membrane proteins translocate the substrate across the membrane.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptide transport system permease protein sequences; e.g. residues 9-282 are 70% similar to CT200; residues 23-270 are 31% similar to UU561; resdiues 73-274 are 29% similar to CT478; 6-274 are 34% similar to OPPC_BACSU; residues 64-274 are 32% similar to OPPC_SALTY; and residues 64-274 are 31% similar to OPPC_ECOLI.

COGS Summary:  COGS Search
BeTs to 11 clades of COG1173
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, permease components
Functional Class:  E,P
The phylogenetic pattern of COG1173 is a-TK-qVCEBRHUj--o-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 90-141 and 145-194 represent blocks BP01681C-D (TRANSPORT PROTEIN PERMEASE TRA) with a combined E-value of 0.00011.

ProDom Summary:  Protein Domain Search
Residues 165-274 are 43% similar to a defined domain of OPPC_BACSU, defined as: TRANSPORT PROTEIN PERMEASE TRANSMEMBRANE SYSTEM PEPTIDE OLIGOPEPTIDE MEMBRANE INNER TRANSPORTER.

Paralogs:  Local Blast Search
CPn0597, a predicted oligopeptide permease sequence, is a probable paralog: residues 73-274 are 29% similar to CPn0597.

Pfam Summary:  Pfam Search
Residues 77 to 283 (E-value = 1e-36) place CPn0200 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
39
transmembrane  
83  
106
transmembrane  
118  
135
transmembrane  
140  
164
transmembrane  
169  
187
transmembrane  
201  
221
transmembrane  
247  
267

PDB Hit:


Gene Protein Sequence:
MENLSSAPSRSIWKSIIQNKMLVLGLTTLIILMLGALLLPWFYQDYEQTS
LKDILVSPCSRFPFGTDTLGRCMFARTLRGLRLSLLIATIATLIDVCVGL
LWATVAISGGKKIDFLMMRTTEILFSLPRIPIIILLLVIFHHGLLPLILA
MTITGWIPISRIIYGQFLLLKNKPFVLSAKAMHASTFHILKKHLLPNTLA
PIISTLIFTIPNAIYTEAFISFLGLGIQPPQASLGTLVKEGINAIDYYPW
LFFFPSLIMIALSISFNLIGEGAKTLCLEEGSHG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAACCTATCCTCAGCTCCATCACGTAGCATTTGGAAATCTATAAT
CCAGAATAAAATGCTTGTTCTAGGCCTCACGACCCTCATAATTCTAATGC
TTGGAGCCCTCCTTTTGCCATGGTTCTATCAAGATTATGAACAGACTTCA
TTAAAAGACATTCTTGTCTCTCCATGCTCGCGCTTTCCCTTTGGCACAGA
CACTCTAGGCAGGTGCATGTTTGCCCGAACTCTACGAGGTCTACGACTCT
CCTTACTCATAGCGACGATCGCTACACTTATTGATGTGTGTGTGGGACTT
TTGTGGGCCACTGTTGCTATATCTGGAGGGAAAAAAATAGATTTCTTAAT
GATGCGAACCACAGAGATTCTCTTTTCTCTACCGAGAATCCCCATCATTA
TTCTTCTTTTAGTCATCTTCCATCACGGACTGCTCCCGCTAATCCTTGCA
ATGACAATTACAGGATGGATTCCTATATCTCGAATTATCTACGGTCAGTT
TCTACTCCTGAAAAATAAGCCCTTTGTCCTTTCTGCAAAAGCCATGCATG
CCTCCACGTTTCATATTCTAAAGAAGCATCTTCTTCCCAATACCCTAGCT
CCCATCATATCTACATTGATTTTTACTATTCCTAACGCTATCTATACCGA
AGCCTTCATTAGCTTCCTGGGTCTAGGAATACAGCCTCCTCAAGCAAGCC
TCGGCACCTTAGTTAAAGAGGGAATCAATGCTATAGATTACTACCCATGG
CTATTTTTCTTCCCCTCTCTAATTATGATTGCCCTCTCTATAAGCTTCAA
TCTCATCGGCGAGGGGGCTAAAACACTATGTCTCGAAGAGGGATCTCATG
GATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy