Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR168 IGR166 IGR163 IGR170 IGR169 IGR164 IGR165 IGR167 CPn0204 CPn0205 CPn0206 CPn0203 oppD, - CPn0201 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 CPn0204 CPn0205 CPn0206 CPn0203 oppD, - CPn0201 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 CPn0206 CPn0203 oppD, - CPn0201 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppF, - CPn0202 oppC_1, - CPn0200 oppF, - CPn0202 oppC_1, - CPn0200 CPn0205 CPn0204
* Calculated from Protein Sequence

Gene ID: CPn0199

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppB_1  

Definition:
oligopeptide ABC transporter (permease)

Gene Start:
241042

Gene Stop:
241986

Gene Length:
945

Molecular Weight*:
34909

pI*:
10.50

Net Charge*:
16.75

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
OPPB is an integral membrane protein with responsibility for translocation of oligopeptides across the membrane. In B. subtilis, the enzyme is required for initiation of sporulation and competence.

From Prosite PDOC00364:

Bacterial binding protein-dependent transport systems are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system.

The integral inner-membrane proteins translocate the substrate across the membrane.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptide ABC transporter sequences; e.g. residues 1-313 are 68% similar to CT199; residues 14-304 are 29% similar to UU562; residues 1-307 are 22% similar to MG077; residues 61-309 are 20% similar to CT479; residues 1-310 are 37% similar to OPPB_BACSU; and residues 1-305 are 32% similar to OPPB_HAEIN.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0601
COG name: Dipeptide/oligopeptide/nickel permeases
Functional Class:  E,P
The phylogenetic pattern of COG0601 is a-TK-qVCEBRHUJgpO-IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
Residues 1-304 span seven regions of similarity to blocks BP01681A-F (TRANSPORT PROTEIN PERMEASE TRA) with a combined E-value of 5.3e-69.

ProDom Summary:  Protein Domain Search
Residues 194-304 are 45% similar to a defined domain of DPPB_BACSU, defined as: TRANSPORT PROTEIN PERMEASE TRANSMEMBRANE SYSTEM PEPTIDE OLIGOPEPTIDE MEMBRANE INNER TRANSPORTER.
Residues 4-97 are 42% similar to a defined domain of O31598_BACSU, defined as: TRANSPORT PROTEIN PERMEASE TRANSMEMBRANE SYSTEM OLIGOPEPTIDE PEPTIDE TRANSPORTER MEMBRANE INNER.

Paralogs:  Local Blast Search
CPn0598 is a possible paralog: residues 61-304 are 22% similar to CPn0598.

Pfam Summary:  Pfam Search
Residues 96 to 305 (E-value = 7.9e-43) place CPn0199 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
10  
27
transmembrane  
96  
118
transmembrane  
137  
156
transmembrane  
163  
187
transmembrane  
192  
215
transmembrane  
220  
239
transmembrane  
244  
262
transmembrane  
275  
292

PDB Hit:


Gene Protein Sequence:
VFSYIKNRILFNLLSLWIVLTLTFLVMKTIPGDPFNDEGCNVLSEEVLQT
LKSRYGLDKPLYQQYTQYLHSIAKLDFGNSLVYKDRKVTNIISTAFPISA
ILGLQSLFLSIGGGIALGTIAALKKKKQRRYILGASILQISIPAFIFATL
LQYVFAVKIPLLPIACWGSFTHTILPTLALAVTPMAFIIQLTYSSVSAAL
NKDYVLLAYAKGLSPLKVVIKHILPYAIFPTISYSAFLTTTVITGTFAIE
NIFCIPGLGKWFICSIKQRDYPVALGLSVFYGTLFMLSSLLSDLIQSIID
PQIRYAHGKEKKRK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGTTCTCATACATAAAAAACCGAATTCTTTTTAATTTGCTTTCTCTATG
GATTGTTTTGACACTCACGTTCCTAGTTATGAAAACCATCCCAGGAGATC
CTTTCAATGACGAAGGCTGCAATGTTCTTTCCGAAGAGGTCTTACAAACC
CTAAAGTCTCGATACGGTTTAGATAAACCTCTCTATCAACAATACACACA
ATACCTCCACTCCATCGCAAAACTAGATTTTGGGAACTCGTTAGTTTATA
AAGATCGCAAAGTAACGAACATCATTTCGACTGCCTTTCCTATATCAGCA
ATCCTAGGATTGCAAAGTCTTTTTCTCTCCATAGGAGGGGGGATCGCTCT
CGGCACCATAGCAGCATTAAAAAAAAAGAAACAAAGACGCTATATTCTAG
GCGCCTCTATACTCCAAATCTCGATTCCTGCTTTTATATTCGCAACACTC
TTACAATATGTCTTTGCTGTAAAAATTCCTCTTCTTCCTATCGCCTGTTG
GGGAAGCTTTACTCATACTATACTCCCGACTCTCGCACTTGCTGTAACTC
CCATGGCCTTCATCATACAGCTTACCTACTCTTCAGTATCCGCAGCATTA
AACAAAGACTATGTCCTACTAGCCTATGCAAAAGGACTCTCCCCACTTAA
AGTCGTTATAAAACATATTTTACCCTACGCCATATTCCCAACCATTTCTT
ATTCCGCATTCCTAACTACTACAGTGATTACAGGAACCTTTGCTATCGAA
AATATCTTCTGTATTCCTGGATTAGGTAAATGGTTTATTTGTAGTATCAA
ACAACGAGACTACCCAGTAGCCCTTGGCTTATCCGTATTTTATGGAACCT
TATTTATGCTCTCTTCTTTACTTTCTGACCTGATTCAATCCATTATAGAT
CCGCAAATCCGTTATGCGCACGGAAAGGAAAAAAAAAGAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy