Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR166 IGR163 IGR162 IGR164 IGR165 IGR167 oppF, - CPn0202 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppF, - CPn0202 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppF, - CPn0202 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppD, - CPn0201 oppD, - CPn0201
* Calculated from Protein Sequence

Gene ID: CPn0198

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppA_4  

Definition:
oligopeptide binding protein

Gene Start:
239169

Gene Stop:
240749

Gene Length:
1581

Molecular Weight*:
59812

pI*:
9.70

Net Charge*:
12.27

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
The oppA sequences are: CPn0195 (oppA_1), CPn0196 (oppA_2), CPn0197 (oppA_3), and CPn0198 (oppA_4).

Blast Summary:  PSI-Blast Search
CPn0198 is similar to CT175, CT198, and CT139. CT175 is a predicted oligopeptide binding protein. Residues 9-524 are 43% similar to CT175.
Numerous significant hits in gapped BLAST to oligopeptide binding protein sequences; e.g. residues 1-502 are 24% similar to TP0585; residues 35-466 are 27% similar to DPPE_BACSU; and residues 29-466 are 28% similar to OPPA_BACSU.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0747
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, periplasmic components
Functional Class:  E
The phylogenetic pattern of COG0747 is a-TK-qVCEBRHUJ--OlIN-
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
Residues 88-111 and 297-312 represent blocks BL01040A-B (Bacterial extracellular solute-binding proteins, family 5 sig) with a combined E-value of 0.0002.

ProDom Summary:  Protein Domain Search
Residues 15-264 are 33% similar to a defined domain of O31305_BORBU, defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR LIPOPROTEIN OLIGOPEPTIDE PEPTIDE BINDING OLIGOPEPTIDE-BINDING.


Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 16 to 524 (E-value = 8.5e-58) place CPn0198 in the SBP_bac_5 family which is described as Bacterial extracellular solute-binding proteins, family 5 (PF00496)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
29
coil-coil  
339  
377

PDB Hit:


Gene Protein Sequence:
MHRLKPTLKSLIPNLLFLLLTLSSCSKQKQEPLGKHLVIAMSHDLADLDP
RNAYLSRDASLAKALYEGLTRETDQGIALALAESYTLSKDHKVYTFKLRP
SVWSDGTPLTAYDFEKSIKQLYFEEFSPSIHTLLGVIKNSSAIHNAQKSL
ETLGIQAKDDLTLVITLEQPFPYFLTLIARPVFSPVHHTLRESYKKGTPP
STYISNGPFVLKKHEHQNYLILEKNPHYYDHESVKLDRVTLKIIPDASTA
TKLFKSKSIDWIGSPWSAPISNEDQKVLSQEKILTYSVSSTTLLIYNLQK
PLIQNKALRKAIAHAIDRKSILRLVPSGQEAVTLVPPNLSQLNLQKEIST
EERQTKARAYFQEAKETLSEKELAELSILYPIDSSNSSIIAQEIQRQLKD
TLGLKIKIQGMEYHCFLKKRRQGDFFIATGGWIAEYVSPVAFLSILGNPR
DLTQWRNSDYEKTLEKLYLPHAYKENLKRAEMIIEEETPIIPLYHGKYIY
AIHPKIQNTFGSLLGHTDLKNIDILS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATAGGCTTAAACCTACCTTAAAAAGTCTGATCCCTAATCTTCTTTT
CTTATTGCTCACTCTTTCAAGCTGCTCAAAGCAAAAACAAGAACCCTTAG
GAAAACATCTCGTTATTGCGATGAGCCATGATCTCGCCGACCTAGATCCT
CGCAATGCCTATTTAAGCAGAGATGCTTCCCTAGCAAAAGCCCTCTATGA
AGGACTGACAAGAGAAACTGATCAAGGAATCGCACTGGCTCTTGCAGAAA
GTTATACCCTGTCAAAAGATCATAAGGTCTATACCTTTAAACTCAGACCT
TCTGTGTGGAGCGATGGCACTCCACTCACTGCTTATGACTTTGAAAAATC
TATAAAACAACTGTACTTCGAAGAATTTTCACCTTCCATACATACTTTAC
TCGGCGTGATTAAAAATTCTTCGGCAATCCACAATGCTCAAAAATCTCTG
GAAACTCTTGGGATACAGGCAAAAGATGATCTTACTTTGGTGATTACCCT
AGAGCAACCTTTCCCATACTTTCTCACACTTATCGCTCGCCCCGTATTCT
CCCCTGTTCATCACACCCTTAGGGAATCCTATAAGAAAGGAACACCCCCA
TCCACATACATCTCCAATGGGCCCTTTGTCTTAAAAAAACATGAACACCA
AAACTACTTAATTTTAGAAAAAAATCCTCACTACTATGATCATGAATCAG
TAAAGTTAGACCGAGTCACCTTAAAAATTATCCCAGACGCCTCCACAGCC
ACGAAACTTTTCAAAAGTAAATCTATAGATTGGATTGGCTCACCTTGGAG
CGCTCCGATATCTAACGAAGACCAAAAAGTTCTCTCCCAAGAAAAGATTC
TTACCTATTCTGTTTCAAGCACCACCCTTCTTATCTATAACCTGCAAAAA
CCTCTAATACAAAATAAAGCCCTCAGGAAAGCCATTGCTCATGCTATTGA
TAGAAAATCTATCTTAAGACTCGTGCCTTCAGGACAAGAAGCTGTAACTC
TAGTTCCCCCAAATCTTTCACAACTCAATCTTCAAAAAGAGATCTCAACA
GAAGAACGACAAACAAAAGCCAGAGCATATTTTCAAGAAGCTAAAGAAAC
ACTTTCTGAAAAAGAACTCGCAGAACTCAGCATCCTCTATCCTATAGATT
CCTCGAATTCCTCCATCATAGCTCAAGAAATCCAAAGACAACTTAAAGAT
ACCTTAGGATTGAAAATCAAAATCCAAGGCATGGAGTACCACTGCTTTTT
AAAGAAACGTCGTCAAGGAGATTTCTTCATAGCGACAGGAGGATGGATTG
CGGAATACGTAAGCCCCGTAGCCTTCCTATCTATTCTAGGCAACCCCAGA
GACCTCACACAATGGAGAAACAGTGATTACGAAAAGACTTTAGAGAAACT
CTATCTCCCTCATGCCTACAAAGAGAATTTAAAACGCGCAGAAATGATAA
TAGAAGAAGAAACCCCGATTATCCCCCTGTATCACGGCAAATATATTTAC
GCTATACATCCTAAAATCCAGAATACATTCGGATCTCTTCTAGGCCACAC
AGATCTCAAAAATATCGATATCTTAAGTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy