Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR166 IGR163 IGR162 IGR164 IGR165 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppC_1, - CPn0200 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 oppD, - CPn0201 gcp_2, - CPn0194 oppD, - CPn0201 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0197

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppA_3  

Definition:
periplasmic oligopeptide ABC transporter

Gene Start:
237578

Gene Stop:
238885

Gene Length:
1308

Molecular Weight*:
50036

pI*:
6.30

Net Charge*:
-5.65

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
From Prosite PDOC00799:

Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins (ABC transporters; see < PDOC00185>) and a high affinity periplasmic solute-binding protein. The later are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into the cytoplasm.

In gram-positive bacteria which are surrounded by a single membrane and have therefore no periplasmic region the equivalent proteins are bound to the membrane via an N-terminal lipid anchor. These homolog proteins do not play an integral role in the transport process per se, but probably serve as receptors to trigger or initiate translocation of the solute throught the membrane by binding to external sites of the integral membrane proteins of the efflux system.

In addition at least some solute-binding proteins function in the initiation of sensory transduction pathways.

The oppA sequences are: CPn0195 (oppA_1), CPn0196 (oppA_2), CPn0197 (oppA_3), and CPn0198 (oppA_4).

Blast Summary:  PSI-Blast Search
CPn0197 is similar to CT139, a predicted oppA periplasmic oligopeptide ABC transporter. Residues 1-434 are 43% similar to CT139.
Numerous significant hits in gapped BLAST to oligopeptide binding protein sequences; e.g. residues 1-434 are 43% similar to CT139; residues 6-430 are 26% similar to CT175; residues 10-431 are 26% similar to CT198; residues 42-350 are 21% similar to TP0585; residues 1-434 are 23% similar to OPPA_BACSU; and residues 6-383 are 25% similar to (S75873) 60 kda antigen [Borrelia coriaceae, C053, ATCC 4338, Peptide, 514 aa] [Borrelia coriaceae].

COGS Summary:  COGS Search
BeTs to 12 clades of COG0747
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, periplasmic components
Functional Class:  E
The phylogenetic pattern of COG0747 is a-TK-qVCEBRHUJ--OlIN-
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
Residues 83-106 and 262-277 represent blocks BL01040A-B (Bacterial extracellular solute-binding proteins, family 5 sig) with a combined E-value of 9.9e-06.

ProDom Summary:  Protein Domain Search
Residues 1-117 are 32% similar to a defined domain of OPPA_BACSU, defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR LIPOPROTEIN OLIGOPEPTIDE PEPTIDE BINDING OLIGOPEPTIDE-BINDING.

Paralogs:  Local Blast Search
Three probable paralogs found in C.pneumoniae: CPn0198, CPn0195, and CPn0196; all of which are predicted oligopeptide binding proteins. Residues 8-430 are 28% similar to CPn0198.

Pfam Summary:  Pfam Search
Residues 4 to 434 (E-value = 1.5e-10) place CPn0197 in the SBP_bac_5 family which is described as Bacterial extracellular solute-binding proteins, family 5 (PF00496)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
19

PDB Hit:


Gene Protein Sequence:
MFSRWITLFLLFISLTGCSSYSSKHKQSLIIPIHDDPVAFSPEQAKRAMD
LSIAQLLFDGLTRETHRESNDLELAIASRYTVSEDFCSYTFFIKDSALWS
DGTPITSEDIRNAWEYAQENSPHIQIFQGLNFSTPSSNAITIHLDSPNPD
FPKLLAFPAFAIFKPENPKLFSGPYTLVEYFPGHNIHLKKNPNYYDYHCV
SINSIKLLIIPDIYTAIHLLNRGKVDWVGQPWHQGIPWELHKQSQYHYYT
YPVEGAFWLCLNTKSPHLNDLQNRHRLATCIDKRSIIEEALQGTQQPAET
LSRGAPQPNQYKKQKPLTPQEKLVLTYPSDILRCQRIAEILKEQWKAAGI
DLILEGLEYHLFVNKRKVQDYAIATQTGVAYYPGANLISEEDKLLQNFEI
IPIYYLSYDYLTQDFIEGVIYNASGAVDLKYTYFP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTTCACGATGGATCACCCTCTTTTTATTATTCATTAGCCTTACTGG
ATGCTCCTCCTACTCTTCAAAACATAAACAATCTTTAATTATTCCCATAC
ATGACGACCCTGTAGCTTTTTCTCCTGAACAAGCAAAACGGGCCATGGAC
CTTTCTATTGCCCAACTTCTTTTTGATGGTCTGACTAGAGAAACTCATCG
CGAATCCAATGATTTGGAATTAGCGATTGCCAGTCGCTATACAGTCTCTG
AAGACTTTTGCTCTTATACGTTCTTTATCAAAGACAGCGCTTTATGGAGC
GACGGAACACCAATCACCTCCGAAGATATCCGTAACGCTTGGGAGTATGC
ACAGGAGAACTCTCCCCACATACAGATCTTCCAAGGACTTAACTTCTCAA
CTCCTTCATCAAATGCAATTACGATTCATCTCGACTCGCCCAACCCCGAT
TTTCCTAAGCTTCTTGCCTTTCCTGCATTTGCTATCTTTAAACCAGAAAA
CCCGAAGCTCTTTAGCGGTCCGTATACTCTTGTAGAGTATTTCCCAGGGC
ATAACATTCATTTAAAGAAAAACCCTAACTATTACGACTACCACTGCGTC
TCCATCAACTCCATCAAACTGCTCATTATTCCTGATATATATACAGCCAT
CCACCTCCTAAACAGAGGCAAGGTGGACTGGGTAGGACAACCCTGGCATC
AAGGGATTCCTTGGGAGCTCCATAAACAATCGCAATATCACTACTACACC
TATCCTGTAGAAGGTGCCTTCTGGCTTTGTCTAAATACAAAATCCCCACA
CTTAAATGATCTTCAAAACAGACATAGACTCGCTACTTGTATTGATAAAC
GTTCTATCATTGAAGAAGCTCTTCAAGGAACCCAACAACCAGCGGAAACA
CTGTCCCGAGGAGCTCCACAACCAAATCAATATAAAAAACAAAAGCCTCT
AACTCCACAAGAAAAACTCGTGCTTACCTATCCCTCAGATATTCTAAGAT
GCCAACGCATAGCAGAAATCTTAAAGGAACAATGGAAAGCTGCTGGAATA
GATTTAATCCTTGAAGGACTCGAATACCATCTGTTTGTTAACAAACGAAA
AGTCCAAGACTACGCCATAGCAACACAGACTGGAGTTGCTTATTACCCAG
GAGCAAATCTAATTTCTGAAGAAGACAAGCTCCTGCAAAACTTTGAGATT
ATCCCGATCTACTATCTGAGCTATGACTATCTCACTCAAGATTTTATAGA
GGGAGTAATCTATAATGCTTCTGGAGCTGTAGATCTCAAATATACCTATT
TCCCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy