Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR160 IGR163 IGR161 IGR162 IGR164 IGR165 argR, - CPn0193 glnQ, - CPn0191 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 argR, - CPn0193 glnQ, - CPn0191 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 argR, - CPn0193 glnP, - CPn0192 glnQ, - CPn0191 glnP, - CPn0192 oppB_1, - CPn0199 oppA_3, - CPn0197 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0196

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppA_2  

Definition:
periplasmic oligopeptide-binding protein precursor or ABC-type dipeptide transport protein

Gene Start:
235939

Gene Stop:
237522

Gene Length:
1584

Molecular Weight*:
61157

pI*:
8.10

Net Charge*:
6.57

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
This protein binds peptides up to five amino acid in length, but is especially efficient in B. subtilis at binding dipeptides. It appears to be required in B. subtilis for sporulation and competence. Amino acids 1-25 comprise a signal peptide. An Xray crystallographic structure is available for this protein.

From Prosite PDOC00799:

Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins (ABC transporters; see < PDOC00185>) and a high affinity periplasmic solute-binding protein. The later are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into the cytoplasm.

The oppA sequences are: CPn0195 (oppA_1), CPn0196 (oppA_2), CPn0197 (oppA_3), and CPn0198 (oppA_4).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to oligopeptide binding protein sequences; e.g. residues 12-523 are 40% similar to CT198; residues 3-483 are 33% similar to CT175; residues 6-371 are 28% similar to CT139; residues 23-524 are 24% similar to TP0585; residues 7-482 are 28% similar to (AF000948) OppAIV [Borrelia burgdorferi]; and residues 31-482 are 27% similar to OPPA_BACSU.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0747
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, periplasmic components
Functional Class:  E
The phylogenetic pattern of COG0747 is a-TK-qVCEBRHUJ--OlIN-
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
Residues 290-305 represent block BL01040B (Bacterial extracellular solute-binding proteins, family 5 sig) with an E-value of 0.0012.

ProDom Summary:  Protein Domain Search
Residues 23-260 are 32% similar to a defined domain of OPPA_BACSU, defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR LIPOPROTEIN OLIGOPEPTIDE PEPTIDE BINDING OLIGOPEPTIDE-BINDING.
Residues 263-335 are 36% similar to a defined domain of DPPA_ECOLI, defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR PEPTIDE OLIGOPEPTIDE LIPOPROTEIN BINDING OLIGOPEPTIDE-BINDING.

Paralogs:  Local Blast Search


Pfam Summary:  Pfam Search
Residues 2 to 526 (E-value = 2.5e-39) place CPn0196 in the SBP_bac_5 family which is described as Bacterial extracellular solute-binding proteins, family 5 (PF00496)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
342  
376

PDB Hit:


Gene Protein Sequence:
MLRFFAVFISTLWLITSGCSPSQSSKGIFVVNMKEMPRSLDPGKTRLIAD
QTLMRHLYEGLVEEHSQNGEIKPALAESYTISEDGTRYTFKIKNILWSNG
DPLTAQDFVSSWKEILKEDASSVYLYAFLPIKNARAIFDDTESPENLGVR
ALDKRHLEIQLETPCAHFLHFLTLPIFFPVHETLRNYSTSFEEMPITCGA
FRPVSLEKGLRLHLEKNPMYHNKSRVKLHKIIVQFISNANTAAILFKHKK
LDWQGPPWGEPIPPEISASLHQDDQLFSLPGASTTWLLFNIQKKPWNNAK
LRKALSLAIDKDMLTKVVYQGLAEPTDHILHPRLYPGTYPERKRQNERIL
EAQQLFEEALDELQMTREDLEKETLTFSTFSFSYGRICQMLREQWKKVLK
FTIPIVGQEFFTIQKNFLEGNYSLTVNQWTAAFIDPMSYLMIFANPGGIS
PYHLQDSHFQTLLIKITQEHKKHLRNQLIIEALDYLEHCHILEPLCHPNL
RIALNKNIKNFNLFVRRTSDFRFIEKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCCGTTTCTTCGCTGTATTTATATCAACTCTTTGGCTCATTACCTC
AGGATGTTCCCCATCCCAATCCTCTAAAGGAATTTTTGTGGTAAATATGA
AGGAAATGCCACGCTCCTTGGATCCTGGAAAAACTCGTCTCATTGCAGAC
CAAACTCTAATGCGTCATCTATATGAAGGACTCGTCGAAGAACATTCCCA
AAATGGAGAGATTAAACCAGCCCTTGCAGAAAGCTACACCATCTCCGAAG
ACGGGACTCGGTACACATTTAAAATCAAAAACATCCTTTGGAGTAACGGA
GACCCTCTGACAGCTCAAGACTTTGTCTCCTCTTGGAAGGAAATCCTAAA
GGAAGATGCGTCCTCCGTATATCTCTATGCGTTTTTACCTATCAAAAATG
CTCGGGCAATCTTTGATGATACTGAGTCTCCAGAAAATCTAGGAGTCCGA
GCTTTAGATAAGCGTCATCTCGAAATTCAGTTAGAAACTCCCTGCGCGCA
TTTCCTACATTTCTTGACTCTTCCTATTTTTTTCCCTGTTCATGAAACTC
TGCGAAACTATAGCACCTCTTTTGAAGAGATGCCCATTACCTGCGGTGCT
TTCCGCCCTGTGTCTCTAGAAAAAGGCCTGAGACTCCATCTAGAGAAAAA
CCCTATGTACCATAATAAAAGCCGTGTGAAACTACATAAAATTATTGTAC
AGTTTATCTCAAACGCTAACACTGCAGCCATTCTATTCAAACATAAGAAA
TTAGATTGGCAAGGACCTCCTTGGGGAGAACCTATCCCTCCAGAAATCTC
AGCTTCTCTACATCAAGATGACCAGCTCTTTTCTCTTCCGGGCGCTTCGA
CTACATGGTTACTCTTTAATATACAAAAAAAACCTTGGAACAATGCTAAA
TTACGCAAGGCATTGAGCCTTGCAATAGACAAAGATATGTTAACCAAAGT
GGTATACCAAGGTCTTGCAGAACCTACAGATCATATCCTACATCCAAGAC
TTTATCCAGGGACCTATCCCGAACGGAAAAGACAAAACGAAAGAATTCTT
GAGGCTCAACAACTCTTTGAAGAAGCTCTAGACGAACTTCAAATGACACG
CGAAGATCTAGAAAAGGAAACTTTGACTTTCTCAACCTTTTCTTTTTCTT
ACGGAAGGATTTGCCAAATGCTAAGAGAACAATGGAAGAAAGTCTTAAAA
TTTACTATCCCTATAGTAGGCCAAGAGTTTTTCACAATACAAAAAAACTT
CCTAGAGGGGAACTATTCCCTAACCGTGAACCAATGGACCGCAGCATTTA
TTGATCCGATGTCTTATCTCATGATCTTTGCCAATCCTGGAGGAATTTCC
CCCTATCACCTCCAAGATTCACACTTTCAAACTCTTCTCATAAAGATCAC
TCAAGAACATAAAAAACACCTACGAAATCAGCTTATTATTGAAGCCCTTG
ACTATTTAGAACACTGTCACATTCTCGAACCACTATGTCATCCAAATCTT
CGAATTGCTTTGAACAAAAACATTAAAAACTTTAATCTTTTTGTTCGACG
AACTTCAGACTTTCGTTTTATAGAAAAACTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy