Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR163 IGR161 IGR162 IGR164 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 oppA_3, - CPn0197 CPn0190 oppA_4, - CPn0198 oppA_2, - CPn0196 oppA_1, - CPn0195 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0195

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
oppA_1  

Definition:
periplasmic oligopeptide-binding protein precursor or ABC-type dipeptide transport protein

Gene Start:
234190

Gene Stop:
235788

Gene Length:
1599

Molecular Weight*:
59734

pI*:
7.20

Net Charge*:
1.51

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
This protein binds peptides up to five amino acid in length, but is especially efficient in B. subtilis at binding dipeptides. It appears to be required in B. subtilis for sporulation and competence. Amino acids 1-25 comprise a signal peptide. An Xray crystallographic structure is available for this protein.

From Prosite PDOC00799:

Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane. The protein components of these traffic systems include one or two transmembrane protein components, one or two membrane-associated ATP-binding proteins (ABC transporters; see < PDOC00185>) and a high affinity periplasmic solute-binding protein. The later are thought to bind the substrate in the vicinity of the inner membrane, and to transfer it to a complex of inner membrane proteins for concentration into the cytoplasm.

The oppA sequences are: CPn0195 (oppA_1), CPn0196 (oppA_2), CPn0197 (oppA_3), and CPn0198 (oppA_4).

Blast Summary:  PSI-Blast Search
Numerous significant hits in gappee BLAST to oligopeptide ABC transporter sequences; e.g. residues 1-532 are 49% similar to CT198; residues 14-527 are 34% similar to CT175; residues 24-500 are 27% similar to TP0585; residues 10-529 are 29% similar to OPPA_BACSU; and residues 38-501 are 28% similar to (AE001139) oligopeptide ABC transporter, periplasmic oligopeptide-binding protein (oppA-2) [Borrelia burgdorferi].

COGS Summary:  COGS Search
BeTs to 12 clades of COG0747
COG name: Dipeptide/oligopeptide/nickel ABC-type transport systems, periplasmic components
Functional Class:  E
The phylogenetic pattern of COG0747 is a-TK-qVCEBRHUJ--OlIN-
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
Residues 295-310 represent block BL01040B (Bacterial extracellular solute-binding proteins, family 5 sig) with an E-value of 0.0056.

ProDom Summary:  Protein Domain Search
Residues 10-265 are 32% similar to a defined domain of OPPA_BACSU; defined as: PROTEIN TRANSPORT PERIPLASMIC SIGNAL PRECURSOR LIPOPROTEIN OLIGOPEPTIDE PEPTIDE BINDING OLIGOPEPTIDE-BINDING.

Paralogs:  Local Blast Search
Three probable paralogs found in C.pneumoniae: residues 15-531 are 43% similar to CPn0196; residues 13-527 are 33% similar to CPn0198; and residues 10-528 are 27% similar to CPn0197.

Pfam Summary:  Pfam Search
Residues 6 to 531 (E-value = 2e-69) place CPn0195 in the SBP_bac_5 family which is described as Bacterial extracellular solute-binding proteins, family 5 (PF00496)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
20

PDB Hit:


Gene Protein Sequence:
MRKISVGICITILLSLSVVLQGCKESSHSSTSRGELAINIRDEPRSLDPR
QVRLLSEISLVKHIYEGLVQENNLSGNIEPALAEDYSLSSDGLTYTFKLK
SAFWSNGDPLTAEDFIESWKQVATQEVSGIYAFALNPIKNVRKIQEGHLS
IDHFGVHSPNESTLVVTLESPTSHFLKLLALPVFFPVHKSQRTLQSKSLP
IASGAFYPKNIKQKQWIKLSKNPHYYNQSQVETKTITIHFIPDANTAAKL
FNQGKLNWQGPPWGERIPQETLSNLQSKGHLHSFDVAGTSWLTFNINKFP
LNNMKLREALASALDKEALVSTIFLGRAKTADHLLPTNIHSYPEHQKQEM
AQRQAYAKKLFKEALEELQITAKDLEHLNLIFPVSSSASSLLVQLIREQW
KESLGFAIPIVGKEFALLQADLSSGNFSLATGGWFADFADPMAFLTIFAY
PSGVPPYAINHKDFLEILQNIEQEQDHQKRSELVSQASLYLETFHIIEPI
YHDAFQFAMNKKLSNLGVSPTGVVDFRYAKEN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCAAGATATCAGTGGGAATCTGTATCACCATTCTCCTTAGCCTCTC
CGTAGTCCTCCAAGGCTGCAAGGAGTCCAGTCACTCCTCTACATCTCGGG
GAGAACTCGCTATTAATATAAGAGATGAACCCCGTTCTTTAGATCCAAGA
CAAGTGCGACTTCTTTCAGAAATCAGCCTTGTCAAACATATCTATGAGGG
ATTAGTTCAAGAAAATAATCTTTCAGGAAATATAGAGCCTGCTCTTGCAG
AAGACTACTCTCTTTCCTCGGACGGACTCACTTATACTTTTAAACTGAAA
TCAGCTTTTTGGAGTAATGGCGACCCCTTAACAGCTGAAGACTTTATAGA
ATCTTGGAAACAAGTAGCTACTCAAGAAGTCTCAGGAATCTATGCTTTTG
CCTTGAATCCAATTAAAAATGTACGAAAGATCCAAGAGGGACACCTCTCC
ATAGACCATTTTGGAGTGCACTCTCCTAATGAATCTACACTTGTTGTTAC
CCTGGAATCCCCAACCTCGCATTTCTTAAAACTTTTAGCTCTTCCAGTCT
TTTTCCCCGTTCATAAATCTCAAAGAACCCTGCAATCCAAATCTCTACCT
ATAGCAAGCGGAGCTTTCTATCCTAAAAATATCAAACAAAAACAATGGAT
AAAACTCTCAAAAAACCCTCACTACTATAATCAAAGTCAGGTGGAAACTA
AAACGATTACGATTCACTTCATTCCCGATGCAAACACAGCAGCAAAACTA
TTTAATCAGGGAAAACTCAATTGGCAAGGACCTCCTTGGGGAGAACGCAT
TCCTCAAGAAACCCTATCCAATTTACAGTCTAAGGGGCACTTACACTCTT
TTGATGTCGCAGGAACCTCATGGCTCACCTTCAATATCAATAAATTCCCC
CTCAACAATATGAAGCTTAGAGAAGCCTTAGCATCAGCCTTAGATAAGGA
AGCTCTTGTCTCAACTATATTCTTAGGCCGTGCAAAAACTGCCGATCATC
TCCTACCTACAAATATTCATAGCTATCCCGAACATCAAAAACAAGAGATG
GCACAACGCCAAGCTTACGCTAAAAAACTCTTTAAAGAAGCTTTAGAAGA
ACTCCAAATCACTGCTAAAGATCTCGAACATCTTAATCTTATCTTTCCCG
TTTCCTCGTCAGCAAGTTCTTTACTAGTCCAACTTATACGAGAACAGTGG
AAAGAAAGTTTAGGGTTCGCTATCCCTATTGTCGGAAAGGAATTTGCTCT
TCTCCAAGCAGACCTATCTTCAGGGAACTTCTCTTTAGCTACAGGAGGAT
GGTTCGCAGACTTTGCTGATCCTATGGCATTTCTAACGATCTTTGCTTAT
CCATCAGGAGTTCCTCCTTATGCAATCAACCATAAGGACTTCCTAGAAAT
TCTACAAAACATAGAACAAGAGCAAGATCACCAAAAACGCTCGGAATTAG
TGTCGCAAGCTTCTCTTTACCTAGAGACCTTTCATATTATTGAGCCGATC
TACCACGACGCATTTCAATTTGCTATGAATAAAAAACTTTCTAATCTAGG
AGTCTCACCAACAGGAGTTGTGGACTTCCGTTATGCTAAGGAAAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy