Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR163 IGR161 IGR158 IGR162 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0194

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gcp_2  

Definition:
O-sialoglycoprotein endopeptidase (glycoprotease)

Gene Start:
233210

Gene Stop:
234244

Gene Length:
1035

Molecular Weight*:
36706

pI*:
6.60

Net Charge*:
-1.64

EC:
3.4.24.57  

Functional Class:
protein fate; degradation of proteins, peptides and glycoproteins  

Pathway: pathway table

Comment:
O-sialoglycoprotein endopeptidase is a neutral metalloprotease that cleaves
specifically o-sialoglycoproteins such as glycophorin A (cleaving,
specifically,
the 31-arg-|-asp-32 bond). O-sialoglycoprotein endopeptidase will not cleave
unglycosylated proteins, desialylated glycoproteins or glycoproteins that are

only N-glycosylated.
Zinc is probably a cofactor.
This protein is probably extracellular, however it is not secreted through
the conventional secretory pathway since it lacks a signal sequence.
This protein is a member of the peptidase family M22; also known as the
glycoprotease family.

Blast Summary:  PSI-Blast Search
CPn0194 is orthologously related to CT197: residues 1-335 of CPn0194 are 65% similar to residues 1-335 of CT197, a predicted gcp O-sialoglycoprotein endopeptidase (glycoprotease) from C. trachomatis.
CPn0194 is also similar to TP0680, UU411, MG046, all predicted O-sialoglycoproteases.

COGS Summary:  COGS Search
BeTs to 17 clades of COG0533
COG name: Metal-dependent proteases with possible chaperone activity
Functional Class:  O
The phylogenetic pattern of COG0533 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 284 (E-value = 1.1e-94) place CPn0194 in the Peptidase_M22 family which is described as Glycoprotease family (PF00814)

PDB Hit:


Gene Protein Sequence:
MLTLGLESSCDETACAIVNEDKQILANIIASQDIHASYGGVVPELASRAH
LHIFPQVINKALQQANLLIEDMDLIAVTQTPGLIGSLSVGVHFGKGIAIG
AKKSLIGVNHVEAHLYAAYMAAQNVQFPALGLVVSGAHTAAFFIENPTSY
KLIGKTRDDAIGETFDKVGRFLGLPYPAGPLIEKLALEGSEDSYPFSPAK
VPNYDFSFSGLKTAVLYAIKGNNSSPRSPAPEISLEKQRDIAASFQKAAC
TTIAQKLPTIIKEFSCRSILIGGGVAINEYFRSAIQTACNLPVYFPPAKL
CSDNAAMIAGLGGENFQKNSSIPEIRICARYQWESVSPFSLASP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCACCCTAGGCTTGGAAAGTTCTTGCGATGAGACTGCCTGCGCTAT
AGTTAATGAGGATAAGCAGATATTAGCAAATATTATTGCCTCTCAAGATA
TCCATGCATCCTATGGCGGAGTCGTTCCTGAACTTGCTTCAAGAGCACAT
CTCCATATCTTCCCACAAGTGATAAATAAAGCTCTACAACAGGCCAACTT
ATTGATCGAAGATATGGATCTGATTGCAGTAACGCAAACTCCAGGGTTGA
TAGGTTCTCTATCAGTAGGAGTGCATTTTGGTAAAGGCATTGCCATAGGA
GCAAAAAAATCCTTGATTGGAGTCAATCACGTCGAAGCTCATCTCTATGC
TGCCTATATGGCAGCGCAAAACGTGCAATTCCCTGCTTTAGGTCTTGTGG
TCTCTGGAGCTCATACCGCAGCGTTTTTTATAGAAAATCCTACATCCTAT
AAACTCATAGGAAAAACTCGAGATGATGCTATAGGAGAAACTTTTGATAA
AGTAGGACGCTTTCTAGGATTACCATACCCTGCAGGCCCATTAATTGAAA
AACTCGCTTTAGAAGGCTCTGAGGACAGTTATCCTTTTAGTCCAGCTAAA
GTCCCAAACTATGACTTTTCATTCAGCGGTCTTAAAACAGCTGTTCTCTA
CGCAATCAAAGGAAATAATAGTAGCCCCCGCTCTCCTGCTCCAGAGATAT
CTTTAGAAAAACAAAGAGATATCGCTGCTTCATTTCAAAAAGCGGCCTGC
ACTACTATTGCACAAAAACTTCCCACTATTATAAAAGAATTTTCGTGCCG
ATCTATACTTATTGGAGGTGGCGTAGCCATTAATGAATACTTTAGATCCG
CAATACAAACTGCGTGTAATCTACCTGTATACTTCCCCCCTGCTAAACTA
TGCTCAGATAATGCTGCTATGATTGCAGGTCTAGGGGGAGAAAATTTTCA
AAAAAACTCTAGTATTCCGGAAATTCGTATATGCGCAAGATATCAGTGGG
AATCTGTATCACCATTCTCCTTAGCCTCTCCGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy