Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR163 IGR161 IGR158 IGR162 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 oppA_3, - CPn0197 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0193

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
argR  

Definition:
arginine repressor

Gene Start:
233126

Gene Stop:
232683

Gene Length:
444

Molecular Weight*:
16007

pI*:
9.20

Net Charge*:
2.43

EC:
 

Functional Class:
regulatory functions  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to arginine repressor sequences; e.g. residues 1-147 are 100% similar to (AE001605) Arginine Repressor [Chlamydia pneumoniae]; residues 7-143 are 41% similar to ARGR_HAEIN; and residues 3-125 are 43% similar to ARGR_ECOLI.
No ortholog in C. trachomatis, T. pallidum, M. genitalium, U. urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1438
COG name: Arginine repressor
Functional Class:  E
The phylogenetic pattern of COG1438 is ------v-ebrh-------n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 66-120 and 17-68 align to blocks PF01316B and PF01316A (both of which are identified as: Arg_repressor), respectively.

ProDom Summary:  Protein Domain Search
Residues 12-125 are 47% similar to a defined domain of ARGR_HAEIN.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 70 (E-value = 2.5e-32) place CPn0193 in the Arg_repressor family which is described as Arginine repressor, DNA binding domain (PF01316)
Residues 72 to 141 (E-value = 4.3e-34) place CPn0193 in the Arg_repressor_C family which is described as Arginine repressor, C-terminal domain (PF02863)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
1  
33

PDB Hit:


Gene Protein Sequence:
MKKKVTIDEALKEILRLEGAATQEELCAKLLAQGFATTQSSVSRWLRKIQ
AVKVAGERGARYSLPSSTEKTTTRHLVLSIRHNASLIVIRTVPGSASWIA
ALLDQGLKDEILGTLAGDDTIFVTPIDEGRLPLLMVSIANLLQVFLD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAAAAGTAACTATAGATGAGGCTTTAAAAGAAATTTTACGTCT
TGAAGGAGCGGCAACTCAGGAGGAATTATGTGCAAAACTCTTAGCTCAAG
GTTTTGCTACAACCCAGTCGTCTGTATCTCGTTGGCTACGAAAGATTCAG
GCTGTAAAGGTTGCTGGAGAGCGTGGTGCTCGTTATTCTTTACCCTCTTC
AACAGAGAAGACCACGACCCGTCATTTGGTGCTCTCTATTCGCCATAACG
CCTCTCTTATTGTAATTCGTACGGTTCCTGGTTCAGCTTCTTGGATCGCT
GCTTTGTTAGATCAAGGGCTCAAAGATGAAATTCTTGGAACTTTGGCAGG
AGATGACACGATTTTTGTCACTCCTATAGATGAAGGGAGGCTCCCATTGT
TGATGGTTTCGATTGCAAATTTACTGCAAGTTTTCTTGGATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy