Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR161 IGR158 IGR162 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0192

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnP  

Definition:
probable amino-acid ABC transporter permease protein

Gene Start:
232634

Gene Stop:
231981

Gene Length:
654

Molecular Weight*:
24002

pI*:
8.60

Net Charge*:
3.99

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:
From Prosite PDOC00364:

Bacterial binding protein-dependent transport systems are multicomponent systems typically composed of a periplasmic substrate-binding protein, one or two reciprocally homologous integral inner-membrane proteins and one or two peripheral membrane ATP-binding proteins that couple energy to the active transport system.

Blast Summary:  PSI-Blast Search
CPn0192 is similar to CT129, a predicted glnP probable amino-acid ABC transporter permease:
residues 1-211 are 70% similar to CT129.
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 52-212 are 48% similar to (AE001090) glutamine ABC transporter, permease protein (glnP) [Archaeoglobus fulgidus]; and residues 47-212 are 42% similar to (AE001734) amino acid ABC transporter, permease protein [Thermotoga maritima].
No significant similarity to M.genitalium, T.pallidum, or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0765
COG name: Amino acid ABC transporter permease component
Functional Class:  E
The phylogenetic pattern of COG0765 is a-----vcEB-HUJ----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 17-104 are 42% similar to a defined domain of YA79_HAEIN, defined as: TRANSPORT PROTEIN TRANSMEMBRANE PERMEASE AMINO-ACID MEMBRANE INNER SYSTEM TRANSPORTER ABC.
Residues 106-165 are 51% similar to a defined domain of O30007_ARCFU, defined as: TRANSPORT PROTEIN TRANSMEMBRANE PERMEASE MEMBRANE INNER SYSTEM TRANSPORTER ABC AMINO-ACID.

Paralogs:  Local Blast Search
No paralogs found in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 15 to 215 (E-value = 1.8e-27) place CPn0192 in the BPD_transp_1 family which is described as Binding-protein-dependent transport system inner membrane component (PF00528)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
22  
40
transmembrane  
57  
75
transmembrane  
84  
101
transmembrane  
124  
141
transmembrane  
148  
165
transmembrane  
187  
204

PDB Hit:


Gene Protein Sequence:
VDHWLAIARLLLRGCGYTLCVSGIGILCGSILGLLIGTVTSLYFPSKLTK
LLANSYVTVIRGTPLFIQILIIYFGLPEVLPIEPTPLVAGIIALSMNSAA
YLAENIRGGINSLSIGQWESAMVLGYKKYQIFVYIIYPQVFKNILPSLTN
EFVSLIKESSILMVVGVPELTKVTKDIVSRELNPMEMYLICAGLYFLMTT
SFSCISRLSEKRRSYDN$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATCATTGGCTAGCTATAGCAAGACTGTTGTTAAGAGGATGCGGATA
CACCTTATGTGTGAGCGGAATCGGCATTCTATGTGGTTCTATTTTAGGTC
TTTTGATTGGAACGGTGACTTCTCTATACTTCCCTTCTAAGTTAACGAAA
CTTTTAGCTAATAGTTATGTGACTGTTATCCGCGGGACTCCTTTATTTAT
TCAAATTTTGATTATATATTTTGGATTGCCTGAAGTTCTCCCCATAGAAC
CCACACCTCTAGTTGCTGGAATTATTGCTTTAAGTATGAATTCTGCAGCA
TATCTTGCAGAAAATATCCGTGGAGGTATCAATTCTCTTTCTATAGGGCA
GTGGGAATCCGCAATGGTTTTGGGATATAAGAAGTATCAAATTTTCGTTT
ATATTATTTATCCTCAAGTTTTTAAAAATATTTTACCATCCTTAACCAAT
GAATTTGTTTCTTTGATCAAGGAAAGTAGTATTTTAATGGTTGTCGGTGT
CCCTGAGTTAACTAAAGTAACTAAGGATATTGTCTCGAGAGAGTTGAACC
CTATGGAAATGTATCTTATTTGTGCTGGGCTATATTTCTTAATGACAACA
TCATTTTCCTGTATTTCTAGGTTATCAGAAAAGAGAAGGAGTTATGACAA
TTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy