Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR161 IGR158 IGR162 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 CPn0190 oppA_2, - CPn0196 oppA_1, - CPn0195 CPn0189 gcp_2, - CPn0194 gcp_2, - CPn0194
* Calculated from Protein Sequence

Gene ID: CPn0191

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glnQ  

Definition:
glutamine ABC transporter, ATP-binding protein

Gene Start:
231991

Gene Stop:
231311

Gene Length:
681

Molecular Weight*:
25235

pI*:
6.70

Net Charge*:
-1.49

EC:
 

Functional Class:
transport and binding proteins; amino acids, peptides and amines  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to ABC transporter sequences; e.g. residues 1-222 are 49% similar to CT130; residues 18-201 are 36% similar to TP0652; residues 13-199 are 31% similar to MG180; residues 3-201 are 37% similar to YQIZ_BACSU; and residues 16-201 are 39% similar to (AE001058) glutamine ABC transporter, ATP-binding protein (glnQ) [Archaeoglobus fulgidus].

COGS Summary:  COGS Search
BeTs to 8 clades of COG1126
COG name: ABC-type polar amino acid transport system, ATPase component
Functional Class:  E
The phylogenetic pattern of COG1126 is a-----vcEB-Huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 33-44 and 124-155 represent blocks BL00211A-B (ABC transporters family proteins) with a combined E-value of 1.8e-18.

ProDom Summary:  Protein Domain Search
Residues 123-169 are 61% similar to a defined domain of AAPP_RHILV, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.
Residues 18-64 are 53% similar to a defined domain of YYBJ_BACSU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Numerous possible paralogs exist, the most similar of which are: CPn0280, CPn0231, CPn0348, CPn0202, and CPn0683. Residues 3-201 are 33% similar to CPn0280.

Pfam Summary:  Pfam Search
Residues 28 to 199 (E-value = 1.4e-51) place CPn0191 in the ABC_tran family which is described as ABC transporter (PF00005)

PDB Hit:


Gene Protein Sequence:
MTIRVRNLAYSVNKKKILDGVTFSLERGHITLFVGKSGSGKTMILRALAG
LVQPTQGDIWIEGEAPALVFQQPELFSHMTVLGNCTHPQIHIKGRSTEEA
REKAFELLHLLDIEEVAKNYPDQLSGGQKQRVAIVRSLCMDKHTLLFDEP
TSALDPFATASFRHLLETLRDQELTVGLTTHDMQFVHSCLDRIYLIDQGT
VAGVYDKRDGELDSGHPLSKYIHSAQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACAATTAGAGTCCGAAACCTTGCCTACTCTGTAAATAAGAAAAAGAT
TCTAGATGGTGTAACTTTTTCTTTAGAGCGAGGGCACATTACACTGTTTG
TTGGGAAGAGTGGTTCAGGAAAAACAATGATTTTACGTGCTTTGGCGGGC
TTAGTCCAGCCCACTCAAGGAGATATTTGGATTGAAGGGGAGGCTCCAGC
TCTAGTTTTCCAACAACCCGAGTTATTTTCCCATATGACAGTATTAGGAA
ATTGCACCCATCCACAAATCCATATCAAGGGTCGTAGTACCGAAGAAGCT
CGAGAAAAGGCGTTCGAGCTTTTACATTTGTTGGATATTGAAGAGGTTGC
TAAGAATTATCCTGACCAGCTCTCTGGGGGACAAAAACAACGTGTGGCTA
TTGTACGTTCTTTATGTATGGATAAACATACATTACTTTTTGATGAACCT
ACATCGGCTTTAGATCCTTTTGCTACGGCATCGTTCCGACATCTTTTAGA
AACACTTCGAGACCAGGAACTGACTGTAGGGTTAACTACTCATGACATGC
AATTTGTTCATAGTTGTTTGGATCGTATCTATCTTATAGATCAAGGAACT
GTTGCGGGGGTCTATGACAAGCGTGACGGAGAGCTCGATTCTGGTCATCC
ATTATCGAAATATATCCACTCTGCTCAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy