Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR161 IGR158 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 CPn0190 oppA_1, - CPn0195 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 CPn0190 oppA_1, - CPn0195 CPn0189 gcp_2, - CPn0194 CPn0188 gcp_2, - CPn0194 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0190

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
229919

Gene Stop:
231277

Gene Length:
1359

Molecular Weight*:
50197

pI*:
5.60

Net Charge*:
-8.74

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
37  
115
non-globular  
231  
317

PDB Hit:


Gene Protein Sequence:
MRKRHSFDSTSTKKEAVSKAIQKIIKIMETTDPSLNVETPNAEIESILQE
IKEIKQKLSKQAEDLGLLEKYCSQETLSNLENTNASLKLSIGSVIEELAS
LKQLVEESIEESLGQQDQLIQSVLIEISDKFLSSIGETLSGNLDMNQNVI
QGLLIKENPEKSEAASVGYVQTLLEPLSKRIGETHKKVATHDVNISSLQF
HMMSVAGGRFRGHIDMNGYRVLGLGEPKNGEDAVSKDYLERYVSSQLTID
KVEDKPITKPNKGKLLYSQGTSPKLESPLPLGLLTSGISGFTWKSASKSN
DGSFPFSALRHKETESDTDCFQITSTTLSGNQAGTYTWSLSLKVLVPSIF
QIEKPEVQLSLVYSYEDWLPIDNIFNMSQPRTIPLALLGQTMLAGQKYDI
LELAAHQTNQTLMISPNCSRFSLQLKQTNQFENSPVDFYIVHAAHSCHWS
GF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAACGTCACTCTTTCGACTCAACCTCTACAAAAAAAGAAGCCGT
CAGTAAAGCTATCCAAAAAATCATCAAGATTATGGAAACAACAGACCCTT
CTTTAAATGTAGAAACCCCCAATGCAGAAATCGAAAGCATTCTCCAAGAA
ATCAAAGAAATTAAACAAAAGTTATCGAAACAAGCAGAAGACCTCGGTCT
TTTAGAAAAATACTGTTCTCAAGAAACCCTCTCTAATCTTGAAAACACTA
ACGCATCGCTCAAGCTTTCCATAGGCAGTGTCATAGAAGAACTCGCTTCT
CTCAAACAACTTGTAGAGGAAAGTATTGAAGAATCCTTAGGGCAACAAGA
CCAACTCATCCAATCTGTACTTATTGAGATCTCTGATAAGTTTCTTTCCT
CTATAGGGGAGACTCTTTCTGGAAATCTTGATATGAACCAGAACGTAATT
CAAGGACTCCTAATCAAAGAAAACCCTGAAAAATCTGAAGCAGCTTCTGT
AGGATATGTACAGACTCTACTAGAGCCTCTAAGTAAAAGGATCGGCGAGA
CTCATAAGAAGGTCGCTACTCATGATGTGAATATCTCCTCCTTGCAATTT
CATATGATGTCAGTGGCAGGAGGTAGGTTCCGTGGTCATATTGATATGAA
TGGCTATCGCGTTTTAGGATTGGGAGAGCCTAAAAATGGAGAAGATGCTG
TCTCTAAGGATTATTTAGAACGTTACGTAAGCTCGCAGCTCACTATAGAC
AAAGTTGAAGACAAGCCCATTACAAAGCCAAATAAGGGAAAATTACTCTA
TTCCCAAGGGACGAGTCCTAAACTTGAAAGTCCCTTACCTTTAGGGCTTC
TGACATCTGGAATCTCAGGATTTACTTGGAAAAGTGCAAGCAAATCTAAC
GATGGAAGCTTCCCTTTTAGTGCTTTAAGACACAAGGAAACAGAGTCGGA
TACAGATTGCTTCCAGATTACTTCCACAACGCTCTCAGGAAATCAAGCAG
GAACCTACACCTGGTCCTTATCTTTAAAAGTGTTGGTGCCTTCAATCTTC
CAAATCGAAAAACCAGAAGTCCAGCTCTCTCTTGTCTACTCTTATGAAGA
CTGGCTTCCTATCGATAATATCTTCAATATGTCTCAGCCTAGGACCATAC
CACTAGCTCTCCTAGGACAAACAATGCTTGCAGGACAAAAATATGATATC
CTAGAGCTCGCCGCACATCAAACAAACCAAACTCTAATGATTAGCCCGAA
CTGTTCTCGATTCTCTCTACAATTAAAACAAACTAATCAGTTTGAAAACT
CCCCTGTCGATTTCTATATTGTCCATGCCGCTCATTCCTGCCACTGGTCA
GGATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy