Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR159 IGR160 IGR157 IGR158 IGR156 argR, - CPn0193 glnQ, - CPn0191 CPn0187 CPn0186 CPn0190 CPn0189 argR, - CPn0193 glnQ, - CPn0191 CPn0187 CPn0186 CPn0190 CPn0189 argR, - CPn0193 glnQ, - CPn0191 glnP, - CPn0192 glnP, - CPn0192 CPn0187 CPn0186 CPn0190 CPn0189 CPn0188 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0189

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
226400

Gene Stop:
229828

Gene Length:
3429

Molecular Weight*:
127331

pI*:
8.10

Net Charge*:
11.46

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0189 is orthologously related to CT131, a hypothetical protein: residues 10-1134 are 52% similar to CT131.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
569  
655

PDB Hit:


Gene Protein Sequence:
MKRRSWLKILGICLGSSIVLGFLIFLPQLLSTESRKYLVFSLIHKESGLS
CSAEELKISWFGRQTARKIKLTGEAKDEVFSAEKFELDGSLLRLLIYKKP
KGITLSGWSLKINEPASIDHPSVSHLDPGSLLTYLNDCKIISEHGFITMK
TVSGSSLSVSGFYLEKSSEKFMTKCVVSEDQQSGNIFIESVLSPDVSISA
QFSSVPVAFFKIFIASPFWDHLLSYEDIINLSAEATHTNDGKISMTASGE
GNQIQMKLQGHIHKSTFYIVEGSSSFIELKPELASALCNQIIPLSTPITS
KQIHATVSYAKIPLDITKWKHIEITSQAQLPEVAIHPKDPNLALQLRDTK
LGIKKTEKFSDIRYSSSTVLGGASPSHLNGLISIDNKKHLTKFRLQQAQL
PHTYLRAIFPQPFVINVPLDVAYYSLNIEGTYKNAHLEADAILDNPLLKL
SCSMSGTWKNFLFKGQGTYHFNKKWQEILSPHFSYAEARFSGKAQITDTN
LFFPKFSGKITARENELLIHAKFGSPNEPIKPETTSILIHGQFCSLPLSL
VSNHLAPFHLKKLTFSFHTDGGKFVTKGNLQALIENPDYPDLNNTRILIP
DLLLSLDESSTSPSSKDLKIQGSGEIFSLPLDSITKTYGKQVRLSPYFGS
SGDLNFVVNYNPKDQNKLTLLSNFKSEALLGELKLVMDFSMKLSSGTQGT
LQWEVSPERYASFFKNASCSPTCLLHRTANVRLDISKLSCPEETKGLSCL
TLLAAGGLEGSLEATPLIFYDNVSKETFIINDFKGSLRANNLDAKIEYDL
KGSCLAPRQDSKTLAEFSLEGQVDHLFSPESREFKQTANWIHIPSSFIAG
IIPMSPGLKAQISSLAGPRINVSIKNAFRFGEGPVDIMVDSENLQAQIPL
ILNEKSILLRENLTAHLSINEDVNKAFLQEFNPLLAGGAYSQYPVTLEID
KQNFYLPIRPYSFEEFRIQSATLDMGKISIANTGTMYALFQFLDITDQKQ
FVESWFTPIFFSVQKGSIICKRLDALIDRRIRLALWGKTDIAHDRLFMTL
GIDPEVIKKYFHNTSLKTKNFFLIKIRGSISSPEVDWSSAYARIALLKSY
SLGNPFSSLADKLFSSLGDSTPPPTVHPFPWEKSNFDSIENK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACGAAGATCATGGCTTAAAATTTTGGGAATCTGTTTAGGCAGCAG
CATTGTCTTGGGATTCCTTATATTCTTGCCCCAACTACTTTCAACAGAAT
CAAGGAAATACCTTGTGTTTTCCCTGATTCATAAAGAATCCGGACTCTCG
TGTTCTGCTGAAGAACTTAAGATTTCATGGTTTGGACGGCAAACAGCTAG
AAAAATAAAACTCACTGGAGAAGCTAAAGATGAGGTCTTTTCTGCTGAGA
AATTCGAACTCGACGGATCTCTATTACGTCTTCTGATTTATAAAAAGCCT
AAAGGGATTACTCTATCAGGATGGTCTTTAAAAATTAATGAGCCTGCCTC
TATAGACCATCCTTCTGTGAGTCACTTAGATCCAGGATCTTTACTTACCT
ACCTAAATGACTGCAAGATTATTTCTGAGCACGGATTTATCACTATGAAG
ACAGTATCAGGATCTTCATTATCTGTATCAGGGTTTTATCTAGAGAAATC
CTCAGAAAAGTTCATGACGAAATGCGTGGTCTCTGAAGATCAGCAATCCG
GGAACATCTTTATAGAGAGTGTACTTTCTCCTGATGTCAGTATTTCCGCT
CAGTTTTCTTCAGTTCCCGTTGCATTTTTTAAAATTTTTATAGCTTCCCC
TTTCTGGGACCATCTTCTCTCTTATGAAGACATAATCAATCTATCAGCAG
AGGCAACACATACCAATGATGGTAAGATTTCTATGACAGCCTCTGGCGAG
GGAAATCAAATTCAAATGAAGCTTCAAGGCCATATTCATAAATCCACATT
TTATATTGTAGAAGGGAGTTCTTCGTTCATAGAACTTAAACCTGAGCTCG
CCTCAGCTCTTTGCAACCAGATCATTCCGCTGTCCACACCCATTACTAGT
AAGCAAATCCATGCTACGGTCTCTTATGCTAAAATTCCCTTGGATATTAC
GAAATGGAAACATATTGAAATTACCTCTCAAGCACAGCTCCCTGAAGTCG
CAATACATCCGAAAGACCCTAATCTTGCATTACAGCTGCGCGACACAAAG
CTAGGAATTAAAAAGACGGAGAAATTCTCAGACATCCGTTACTCCTCATC
TACAGTCTTAGGAGGAGCTTCTCCCTCTCACCTTAATGGTTTAATCAGTA
TAGATAACAAAAAACATCTTACTAAATTTCGTCTACAACAAGCACAACTC
CCCCACACCTATCTAAGAGCCATTTTCCCTCAACCTTTCGTGATCAATGT
TCCCCTGGATGTTGCTTATTATTCATTAAATATCGAAGGGACGTACAAAA
ATGCTCACTTAGAGGCAGATGCTATCCTAGATAACCCGCTATTGAAATTG
TCATGCTCCATGTCTGGAACATGGAAAAATTTTCTTTTTAAAGGGCAAGG
AACGTACCACTTTAATAAAAAATGGCAGGAGATTCTCTCTCCCCACTTCT
CTTACGCTGAAGCTAGATTCTCAGGAAAAGCACAAATTACCGATACGAAT
CTCTTTTTCCCTAAATTTTCTGGAAAAATTACTGCAAGAGAAAATGAGCT
GCTCATCCATGCAAAATTTGGTTCCCCTAATGAACCTATAAAACCTGAAA
CTACCTCTATACTCATCCACGGACAATTTTGTTCTCTGCCACTCAGCCTA
GTTTCTAATCACCTAGCCCCCTTCCATTTGAAGAAATTGACATTTTCCTT
CCATACGGATGGAGGTAAGTTTGTAACCAAAGGAAACCTCCAAGCTCTTA
TTGAGAATCCAGACTATCCCGACCTAAATAATACGCGTATCCTAATCCCT
GATCTTCTTCTTTCTCTTGATGAATCCTCAACTTCACCTTCTTCAAAAGA
CTTGAAAATCCAGGGTTCTGGAGAGATATTTTCTTTGCCTCTGGATTCTA
TTACTAAGACCTATGGGAAACAAGTGCGTCTCTCTCCTTATTTTGGTTCC
TCTGGAGACTTGAACTTTGTAGTAAACTACAATCCTAAAGATCAGAATAA
GCTCACACTACTATCTAACTTTAAGTCAGAAGCTCTCCTAGGAGAACTGA
AGTTAGTCATGGACTTTTCTATGAAGCTATCTTCAGGAACTCAGGGAACT
CTCCAGTGGGAAGTGAGCCCAGAACGTTATGCAAGTTTCTTTAAAAACGC
ATCATGCTCTCCCACCTGTTTGCTTCATAGAACTGCAAATGTACGCTTAG
ACATCTCAAAACTCTCTTGTCCAGAGGAAACCAAAGGTTTATCTTGTCTC
ACGCTTCTTGCCGCAGGAGGACTTGAAGGTTCATTAGAAGCAACACCGTT
GATCTTCTATGATAATGTGTCTAAAGAGACTTTTATTATTAATGACTTTA
AAGGTTCTTTGCGAGCCAACAATTTAGACGCTAAAATAGAATATGATCTT
AAAGGCTCGTGTCTAGCTCCTAGGCAAGACTCTAAAACTCTTGCAGAATT
TTCATTAGAAGGACAGGTAGATCATCTGTTCTCTCCAGAGTCTCGAGAAT
TTAAACAAACTGCAAATTGGATTCACATACCCTCTTCGTTCATTGCTGGA
ATCATTCCCATGTCTCCAGGATTGAAAGCTCAGATATCCTCGCTTGCAGG
CCCTAGAATCAACGTATCAATTAAAAATGCGTTCCGATTTGGAGAAGGCC
CTGTCGACATTATGGTCGACTCTGAAAACCTTCAAGCTCAGATTCCACTG
ATCTTAAACGAAAAGTCCATCTTACTGAGAGAGAATCTAACAGCGCACCT
TAGTATAAATGAAGATGTAAATAAGGCTTTCCTACAAGAGTTTAATCCCC
TCTTAGCAGGGGGAGCCTACTCACAATACCCAGTAACCTTAGAGATCGAT
AAACAAAACTTCTATCTCCCTATACGCCCGTATTCTTTTGAAGAATTCCG
CATCCAATCCGCAACATTGGATATGGGGAAAATCTCAATAGCAAATACAG
GAACTATGTATGCTCTTTTCCAATTCCTTGATATTACGGATCAAAAGCAA
TTTGTAGAATCTTGGTTCACTCCAATTTTCTTTTCTGTACAAAAAGGCTC
TATCATTTGTAAGCGCCTCGACGCCCTTATCGATCGTAGAATCCGCCTTG
CTCTATGGGGGAAAACTGATATCGCTCATGATCGTCTGTTTATGACCTTG
GGTATCGATCCTGAAGTTATTAAGAAATACTTTCATAACACCTCTTTAAA
AACTAAAAACTTCTTCCTTATAAAAATCCGAGGATCCATCTCGTCTCCTG
AAGTGGACTGGTCTTCAGCTTACGCTAGAATCGCTCTATTAAAAAGCTAC
AGTCTTGGGAACCCGTTTAGTAGTCTTGCCGATAAGCTATTCTCTTCTCT
TGGCGACTCTACCCCCCCACCAACAGTACACCCCTTCCCTTGGGAAAAAT
CTAATTTTGATTCTATAGAAAATAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy