Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR154 IGR157 IGR158 IGR156 IGR155 accB, - CPn0183 rpe, - CPn0185 CPn0187 CPn0186 CPn0190 CPn0189 accB, - CPn0183 rpe, - CPn0185 CPn0187 CPn0186 CPn0190 CPn0189 accB, - CPn0183 rpe, - CPn0185 efp1, - CPn0184 efp1, - CPn0184 CPn0187 CPn0186 CPn0190 CPn0189 CPn0188 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0188

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
225111

Gene Stop:
226403

Gene Length:
1293

Molecular Weight*:
49295

pI*:
10.20

Net Charge*:
18.77

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Possibly a Chlamydia-specific protein.

Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0188 is similar to AJ235272, an unknown protein in Rickettsia proazekii (E value 1e-09 where E value of the query protein to itself and an ortholog is 0.0 and e-142, respectively) and AJ010131(yfkH) in Bacillus cereus (E value of 4e-08).

CPn0188 is orthologously related to CT132, a hypothetical protein: residues 19-429 are 51% similar to CT132.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1295
COG name: tRNA-processing ribonuclease BN
Functional Class:  J
The phylogenetic pattern of COG1295 is -----q-cEbRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 36 to 291 (E-value = 2.5e-06) place CPn0188 in the Ribonuclease_BN family which is described as Ribonuclease BN-like family (PF03631)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
48  
65
transmembrane  
85  
102
transmembrane  
107  
125
transmembrane  
152  
174
transmembrane  
188  
212
transmembrane  
228  
252
transmembrane  
257  
281
transmembrane  
298  
316

PDB Hit:


Gene Protein Sequence:
MFRKLFPFSKKKTGQKQRLRNNGLLQAIIQSIKVLLHNEASKEACVLSYY
GLLTCVPILVFFLRLSQHLFTNLNWKEWLIIKFPDYKKPIVAIVEAAYHA
TESNIGLVLVGSFFVFCWAGILMLLSLEDGLNKIFRTSWTPISLKRLVSY
FVITLVSPMIFIIVCGSWIYITQIMPIQYAKLFSLSHSMTALYFISRFVP
YLLLYLALFCCYAFLPRVAIQKTSALISTLIIGSVWIVFQKAFFSLQVSI
FNYSFTYGALVALPSFLLLLYIYTMIYLFGGALTFIIQNRGCTFIFLGDK
ILPSCYLQLITSTYILALTTRQFNEGLSPLTAQFIAKQSKVPIGEVSQCL
DVLEKEGFLFPYNNGYQPVFNFSELTIKDIADKLLHREIFKKFNPDLGIT
FIENSFQNIFNQASKNKENLTLSEIARRIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTCGAAAACTTTTCCCGTTTTCTAAAAAAAAAACAGGTCAGAAGCA
ACGTCTTCGAAACAATGGACTTCTGCAAGCGATCATTCAATCAATAAAAG
TCTTACTACATAACGAAGCTTCCAAGGAAGCCTGCGTGTTAAGCTACTAT
GGTTTGCTTACTTGTGTTCCTATTTTAGTATTCTTTCTAAGGCTTTCCCA
ACACTTATTCACTAATCTGAATTGGAAAGAATGGTTGATTATCAAATTCC
CAGATTATAAAAAGCCAATCGTAGCTATTGTGGAAGCCGCATATCATGCT
ACAGAAAGCAATATAGGATTAGTCCTAGTTGGAAGCTTTTTTGTTTTCTG
TTGGGCTGGCATTTTAATGCTCTTATCTCTAGAAGATGGCCTAAATAAGA
TCTTCCGCACCAGCTGGACTCCAATATCTTTAAAGAGGTTAGTCTCTTAT
TTTGTGATTACCTTAGTGAGTCCCATGATTTTTATTATCGTCTGTGGTTC
CTGGATTTATATTACACAGATCATGCCTATCCAATACGCTAAGTTGTTTT
CTCTCAGCCATTCCATGACAGCATTGTACTTTATTTCTAGGTTTGTCCCC
TACCTGCTGCTCTACCTAGCTCTATTTTGCTGTTATGCTTTTCTTCCTCG
CGTTGCAATCCAAAAAACATCAGCTCTTATCTCTACGCTAATCATAGGAT
CTGTATGGATAGTCTTTCAAAAGGCATTCTTTAGCCTTCAAGTCTCTATT
TTTAACTATAGCTTCACTTATGGCGCCCTCGTAGCCCTGCCTTCATTCCT
TCTCCTGCTATATATCTATACAATGATCTACCTATTCGGAGGAGCACTGA
CATTTATTATCCAGAATCGAGGGTGCACTTTCATATTTCTTGGGGACAAA
ATCCTGCCCAGCTGTTATTTACAACTCATTACCTCAACATATATTCTAGC
TTTGACAACACGTCAGTTCAATGAAGGCCTCTCCCCTTTAACTGCTCAAT
TCATCGCCAAACAATCGAAAGTACCTATTGGTGAGGTCTCTCAATGTCTA
GATGTATTAGAAAAAGAAGGTTTTCTTTTTCCTTATAACAATGGGTACCA
GCCTGTCTTCAATTTCTCTGAACTTACAATCAAAGATATTGCTGACAAAC
TCCTGCATCGGGAAATTTTCAAGAAATTCAATCCCGACCTTGGGATTACT
TTCATAGAAAACAGCTTCCAGAACATATTTAACCAAGCTTCTAAAAATAA
AGAGAATCTTACTCTTAGCGAGATTGCTAGGCGAATCAAATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy