Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR154 IGR157 IGR156 IGR155 rpe, - CPn0185 accC, - CPn0182 CPn0187 CPn0186 CPn0189 rpe, - CPn0185 accC, - CPn0182 CPn0187 CPn0186 CPn0189 rpe, - CPn0185 accC, - CPn0182 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0187 CPn0186 CPn0189 CPn0188 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0187

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (basic)

Gene Start:
224248

Gene Stop:
225048

Gene Length:
801

Molecular Weight*:
30386

pI*:
10.30

Net Charge*:
16.60

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
CPn0187 is orthologously related to CT133: residues 1-265 of
CPn0187 are 56% similar to residues 1-265 of CT133, a hypothetical,
genus specific protein from C. trachomatis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0500
COG name: SAM-dependent methyltransferases
Functional Class:  R
The phylogenetic pattern of COG0500 is AMTKYQVCEBRHUJgPOLINX
Number of proteins in this genome belonging to this COG is 4

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MHSKFLSRRKKNSSHKEETSWDCIASSYNKIVQDKGHYYHRETILPQLLP
SLTLGSKSSVLDIGCGQGFLERALPKECRYLGIDISSRLIALAKKMRSVN
SHQFKVADLSKRLEFVEPTLFSHAVAILSLQNMEFPGEAIRNTATLLEPL
GQFFIVLNHPCFRIPRASSWHYDENKKAISRHIDRYLSPMKIPIMAHPGQ
KDSPSTLSFHFPLSYWFKELSSHGFLVSGLEEWTSSKTSTGKRAKAENLC
RKEFPLFLMISCIKIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTCAAAATTTCTTTCTCGAAGAAAAAAAAATAGTTCTCATAAGGA
GGAAACCTCTTGGGATTGTATAGCCTCAAGTTACAATAAGATAGTCCAAG
ATAAAGGGCACTACTATCATAGAGAAACTATCCTTCCCCAACTCCTGCCT
TCACTCACCTTAGGTTCAAAAAGTTCTGTATTGGATATTGGCTGCGGTCA
AGGTTTTTTAGAAAGGGCCCTTCCTAAGGAATGTCGTTATCTAGGCATAG
ATATCTCTTCTAGATTGATTGCTCTAGCAAAGAAAATGCGATCGGTAAAC
TCTCATCAGTTTAAGGTTGCAGATCTTAGCAAACGCCTAGAGTTCGTAGA
ACCGACATTATTCTCTCATGCAGTAGCAATCCTCTCCCTTCAAAATATGG
AATTCCCCGGAGAGGCTATACGTAATACAGCTACGCTCCTCGAACCACTC
GGGCAATTTTTTATAGTTTTAAACCATCCTTGTTTTCGTATTCCTAGGGC
ATCATCCTGGCACTATGATGAAAATAAAAAAGCTATCTCTCGTCATATAG
ATCGTTATCTCTCCCCAATGAAAATCCCAATCATGGCTCACCCAGGACAA
AAAGATTCGCCTTCTACCCTCTCCTTTCACTTTCCTCTAAGCTATTGGTT
TAAAGAACTGTCTTCTCATGGATTCTTAGTTTCAGGTCTTGAGGAATGGA
CATCTTCAAAAACCTCAACAGGAAAACGAGCTAAGGCAGAAAACCTTTGT
CGAAAGGAATTTCCATTATTCCTTATGATTTCATGCATTAAGATAAAATA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy