Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR154 IGR157 IGR153 IGR156 IGR155 CPn0180 rpe, - CPn0185 accC, - CPn0182 CPn0187 CPn0186 CPn0189 CPn0180 rpe, - CPn0185 accC, - CPn0182 CPn0187 CPn0186 CPn0189 rpe, - CPn0185 accC, - CPn0182 CPn0181 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0180 CPn0181 CPn0187 CPn0186 CPn0189 CPn0188 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0186

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
222899

Gene Stop:
224071

Gene Length:
1173

Molecular Weight*:
42495

pI*:
4.50

Net Charge*:
-19.32

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0186 is similar to MG328 in M.genitalium and MP0526 in M. pneumoniae, both hypothetical proteins.

CPn0186 is weakly similar to CT768, a predicted conserved hypothetical protein. Residues 100-491 are 20% similar to CT768.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0419
COG name: ATPase involved in DNA repair
Functional Class:  L
The phylogenetic pattern of COG0419 is amtkyqvceb------ol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0186 is similar to CPn1054, a hypothetical protein: residues 11-277 are 21% similar to residues 754-1001.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
94
coil-coil  
111  
263
coil-coil  
274  
336
non-globular  
341  
390

PDB Hit:


Gene Protein Sequence:
MSSPVNNTPSAPNIPIPAPTTPGIPTTKPRSSFIEKVIIVAKYILFAIAA
TSGALGTILGLSGALTPGIGIALLVIFFVSMVLLGLILKDSISGGEERRL
REEVSRFTSENQRLTVITTTLETEVKDLKAAKDQLTLEIEAFRNENGNLK
TTAEDLEEQVSKLSEQLEALERINQLIQANAGDAQEISSELKKLISGWDS
KVVEQINTSIQALKVLLGQEWVQEAQTHVKAMQEQIQALQAEILGMHNQS
TALQKSVENLLVQDQALTRVVGELLESENKLSQACSALRQEIEKLAQHET
SLQQRIDAMLAQEQNLAEQVTALEKMKQEAQKAESEFIACVRDRTFGRRE
TPPPTTPVVEGDESQEEDEGGTPPVSQPSSPVDRATGDGQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCATCTCCTGTAAATAACACACCCTCAGCACCAAACATTCCAATACC
AGCGCCCACGACTCCAGGTATTCCTACAACAAAACCTCGTTCTAGTTTCA
TTGAAAAGGTTATCATTGTAGCTAAGTACATACTATTTGCAATTGCAGCC
ACATCAGGAGCACTCGGAACAATTCTAGGTCTATCTGGAGCGCTAACCCC
AGGAATAGGTATTGCCCTTCTTGTTATCTTCTTTGTTTCTATGGTGCTTT
TAGGTTTAATCCTTAAAGATTCTATAAGTGGAGGAGAAGAACGCAGGCTC
AGAGAAGAGGTCTCTCGATTTACAAGTGAGAATCAACGGTTGACAGTCAT
AACCACAACACTTGAGACTGAAGTAAAGGATTTAAAAGCAGCTAAAGATC
AACTTACACTTGAAATCGAAGCATTTAGAAATGAAAACGGTAATTTAAAA
ACAACTGCTGAGGACTTAGAAGAGCAGGTTTCTAAACTTAGCGAACAATT
AGAAGCACTAGAGCGAATTAATCAACTTATCCAAGCAAACGCTGGAGATG
CTCAAGAAATTTCGTCTGAACTAAAGAAATTAATAAGCGGTTGGGATTCC
AAAGTTGTTGAACAGATAAATACTTCTATTCAAGCATTGAAAGTGTTATT
GGGTCAAGAGTGGGTGCAAGAGGCTCAAACACACGTTAAAGCAATGCAAG
AGCAAATTCAAGCATTGCAAGCTGAAATTCTAGGAATGCACAATCAATCT
ACAGCATTGCAAAAGTCAGTTGAGAATCTATTAGTACAAGATCAAGCTCT
AACAAGAGTAGTAGGTGAGTTGTTAGAGTCTGAGAACAAGCTAAGCCAAG
CTTGTTCTGCGCTACGTCAAGAAATAGAAAAGTTGGCCCAACATGAAACA
TCTTTGCAACAACGTATTGATGCGATGCTAGCCCAAGAGCAAAATTTGGC
AGAGCAGGTCACAGCCCTTGAAAAAATGAAACAAGAAGCTCAGAAGGCTG
AGTCCGAGTTCATTGCTTGTGTACGTGATCGAACTTTCGGACGTCGTGAA
ACACCTCCACCAACAACACCTGTAGTTGAAGGTGATGAAAGTCAAGAAGA
AGACGAAGGAGGTACTCCCCCAGTATCACAACCATCTTCACCCGTAGATA
GAGCAACAGGAGATGGTCAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy