Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR154 IGR157 IGR153 IGR156 IGR151 IGR155 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0187 CPn0186 CPn0189 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0187 CPn0186 CPn0189 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0179 CPn0181 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0180 CPn0178 CPn0181 CPn0179 CPn0187 CPn0186 CPn0188 CPn0188 CPn0189
* Calculated from Protein Sequence

Gene ID: CPn0185

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rpe  

Definition:
D-ribulose-phosphate-3 epimerase

Gene Start:
222451

Gene Stop:
221762

Gene Length:
690

Molecular Weight*:
24940

pI*:
4.60

Net Charge*:
-12.03

EC:
5.1.3.1  

Functional Class:
energy metabolism; pentose phosphate pathway  

Pathway: pathway table
Carbohydrate Metabolism; Pentose phosphate cycle Energy Metabolism; Carbon fixation

Comment:
This enzyme coverts D-ribulose-5-phosphate to
D-xylulose.

From Prosite PDOC00833:

Ribulose-phosphate 3-epimerase (EC 5.1.3.1) (also
known as pentose-5-phosphate 3-epimerase or PPE)
is the enzyme that converts D-ribulose
5-phosphate into D-xylulose 5-phosphate in
Calvin's reductive pentose phosphate cycle. In
Alcaligenes eutrophus two copies of the gene
coding for PPE are known,one is chromosomally
encoded (cbbEC), the other one is on a plasmid
(cbbeP). PPE has been found in a wide range of
bacteria, archebacteria, fungi and plants.

Blast Summary:  PSI-Blast Search
Cpn0185 is similar to TP0945 in T. pallidum,
UU456 in U. urealyticum and MG112 in M. genitalium.

CPn0185 is orthologously related to CT121 and
they share 69% similarity.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0036
COG name: Pentose-5-phosphate-3-epimerase
Functional Class:  G
The phylogenetic pattern of COG0036 is -m--yqvcEbrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 8 to 210 (E-value = 1.3e-80) place CPn0185 in the Ribul_P_3_epim family which is described as Ribulose-phosphate 3 epimerase family (PF00834)

PDB Hit:


Gene Protein Sequence:
VKKQESVLVGPSIMGADLTCLGVEAKKLEQAGSDFIHIDIMDGHFVPNLT
FGPGIIAAINRSTDLFLEVHAMIYNPFEFIESFVRSGADRIIVHFEASED
IKELLSYIKKCGVQAGLAFSPDTSIEFLPSFLPFCDVVVLMSVYPGFTGQ
SFLPNTIEKIAFARHAIKTLGLKDSCLIEVDGGIDQQSAPLCRDAGADIL
VTASYLFEADSLAMEDKILLLRGENYGVK$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAAGAAACAGGAATCCGTATTAGTTGGCCCTTCGATTATGGGGGCAGA
TCTTACCTGTTTGGGTGTAGAAGCAAAAAAACTAGAGCAGGCGGGAAGTG
ATTTTATACACATAGATATCATGGATGGCCACTTTGTTCCGAACCTTACT
TTTGGTCCAGGGATCATTGCTGCCATTAATAGATCTACGGATCTATTTTT
AGAAGTCCACGCTATGATTTACAATCCTTTTGAATTTATAGAAAGTTTCG
TTCGTTCTGGTGCGGATAGAATTATAGTACACTTTGAAGCTTCAGAGGAT
ATAAAAGAGCTTCTATCTTATATAAAAAAATGTGGGGTTCAAGCGGGTCT
AGCTTTTTCTCCCGATACTTCAATCGAATTTCTTCCTTCTTTCCTTCCGT
TTTGTGATGTCGTTGTGCTAATGTCAGTTTATCCGGGATTTACAGGACAG
AGCTTTTTACCAAATACAATAGAAAAGATTGCTTTTGCACGTCATGCGAT
AAAGACTTTAGGTTTAAAGGATTCTTGTTTAATAGAAGTAGATGGAGGCA
TAGATCAGCAATCTGCGCCGTTATGTCGAGATGCAGGAGCAGATATTTTA
GTCACAGCTTCTTACTTATTCGAAGCAGATTCATTAGCAATGGAAGATAA
AATTTTGTTGCTGCGAGGAGAAAATTATGGTGTTAAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy