Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR154 IGR157 IGR150 IGR153 IGR156 IGR151 IGR155 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0187 CPn0186 CPn0176 CPn0188 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0187 CPn0186 CPn0176 CPn0188 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0179 CPn0181 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0178 CPn0180 CPn0179 CPn0181 CPn0187 CPn0186 CPn0176 CPn0188
* Calculated from Protein Sequence

Gene ID: CPn0183

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accB  

Definition:
biotin carrier protein of acetyl-COA carboxylase (BCCP)

Gene Start:
221195

Gene Stop:
220692

Gene Length:
504

Molecular Weight*:
18446

pI*:
4.90

Net Charge*:
-4.04

EC:
6.4.1.2  

Functional Class:
energy metabolism  
fatty acid and phospholipid metabolism; biosynthesis  

Pathway: pathway table
Fatty acid biosynthesis (path 1)
Propanoate metabolism
Pyruvate metabolism

Comment:
Active in the first step of long-chain fatty acid synthesis as well as in
pyruvate metabolism.

Blast Summary:  PSI-Blast Search
CPn0183 is orthologous to CT123, a predicted biotin carrier protein of acetyl-COA carboxylase (BCCP):
residues 1-164 are 75% similar to CT123. No similarity to T.pallidum, M.genitalium, or
U.urealyticum.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0511
COG name: Biotin carboxyl carrier protein of acetyl-CoA carboxylase
Functional Class: I
The phylogenetic pattern of COG0511 is AmtKYQvceBRhuj---linx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 88 to 162 (E-value = 1.5e-25) place CPn0183 in the Biotin_lipoyl family which is described as Biotin-requiring enzyme (PF00364)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
122

PDB Hit:


Gene Protein Sequence:
MDLKQIEKLMIAMGRNGMKRFAIKREGLELELERDTREGNRQEPVFYDSR
LFSGFSQERPIPTDPKKDTIKETTTENSETSTTTSSGDFISSPLVGTFYG
SPAPDSPSFVKPGDIVSEDTIVCIVEAMKVMNEVKAGMSGRVLEVLITNG
DPVQFGSKLFRIAKDAS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACTTAAAACAAATAGAAAAGCTCATGATTGCTATGGGACGCAATGG
TATGAAGCGTTTTGCTATAAAACGTGAAGGGCTTGAATTGGAGTTGGAAA
GAGATACTAGGGAGGGGAATAGACAAGAGCCTGTGTTTTATGACAGCAGG
TTATTTAGTGGATTTTCTCAAGAACGACCTATCCCAACGGACCCTAAAAA
AGATACAATTAAAGAGACTACTACAGAAAATTCAGAAACTTCTACTACAA
CAAGTTCCGGAGACTTTATAAGTTCTCCTTTAGTGGGAACTTTCTATGGT
TCTCCAGCCCCAGATTCTCCTTCTTTTGTAAAACCTGGCGATATTGTTTC
GGAAGATACTATTGTTTGTATCGTTGAGGCTATGAAAGTAATGAATGAAG
TGAAAGCAGGAATGAGTGGGCGTGTTCTTGAAGTATTGATTACCAATGGG
GATCCTGTCCAATTTGGGTCTAAGTTGTTTCGTATAGCTAAAGATGCATC
ATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy