Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR149 IGR154 IGR150 IGR153 IGR156 IGR151 IGR155 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0175 CPn0187 CPn0186 CPn0176 CPn0178 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0175 CPn0187 CPn0186 CPn0176 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0179 CPn0181 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0178 CPn0180 CPn0179 CPn0181 CPn0187 CPn0186 CPn0176 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0182

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
accC  

Definition:
biotin carboxylase

Gene Start:
220695

Gene Stop:
219331

Gene Length:
1365

Molecular Weight*:
50067

pI*:
6.60

Net Charge*:
-2.74

EC:
 

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table

Comment:
Active in the first step of long-chain fatty acid synthesis.

Blast Summary:  PSI-Blast Search
CPn0182 is similar to CT124, a predicted accC biotin carboxylase: residues
1-450 are 88% similar to CT124. Very weak similarities are seen to CT762 and
TP0695.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0439
COG name: Biotin carboxylase
Functional Class:  I
The phylogenetic pattern of COG0439 is amt-YQ-CeBRhuj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No obvious paralogs in C.pneumoniae. Very weak similarity is seen
to CPn0905.

Pfam Summary:  Pfam Search
Residues 1 to 112 (E-value = 8.7e-44) place CPn0182 in the CPSase_L_chain family which is described as Carbamoyl-phosphate synthase L chain, N-terminal domain (PF00289)
Residues 114 to 328 (E-value = 1.3e-99) place CPn0182 in the CPSase_L_D2 family which is described as Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786)
Residues 335 to 441 (E-value = 3.3e-64) place CPn0182 in the Biotin_carb_C family which is described as Biotin carboxylase C-terminal domain (PF02785)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
80  
210

PDB Hit:


Gene Protein Sequence:
MKKVLIANRGEIAVRIIRACHDLGLSTVAVYSLADQEALHVLLADEAICI
GEPQAAKSYLKISNILAACEITGADAVHPGYGFLSENANFASICESCGLT
FIGPSSESIAMMGDKIAAKSLAKKIKCPVIPGSEGIIEDESEGLKIAEKI
GFPIVIKAVAGGGGRGIRIVKEKDEFYRAFSAARAEAEAGFNNPNVYIEK
FIENPRHLEIQVIGDTHGNYVHLGERDCTIQRRRQKLIEETPSPILNAEI
RVKVGKVAVDLARSAGYFSVGTVEFLLDKDKKFYFMEMNTRIQVEHTITE
EVTGIDLVKEQIHVAMGNKLPWKQKNIEFSGHIIQCRINAEDPTNNFSPS
PGRLDYYLPPAGPSIRVDGACYSGYAIPPYYDSMIAKVIAKGKNREEAIA
IMKRALKEFHIGGVQSTIPFHQFMLDNPKFLESNYDINYIDNLLAQGNSF
FKEF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAAAGTCTTAATCGCTAATAGAGGGGAAATTGCTGTTAGAATTAT
ACGTGCCTGTCATGATTTAGGATTGTCGACAGTGGCTGTATATTCTTTAG
CAGATCAAGAGGCTCTCCACGTACTTCTTGCTGACGAGGCTATTTGTATT
GGAGAGCCTCAAGCAGCAAAGTCTTATTTAAAGATATCCAATATCTTGGC
TGCCTGTGAGATCACAGGAGCTGATGCTGTGCATCCTGGATATGGGTTTT
TAAGTGAAAACGCAAACTTTGCTTCAATATGCGAGAGCTGTGGCTTAACC
TTTATAGGGCCGAGTTCAGAGTCTATTGCTATGATGGGGGATAAGATTGC
TGCGAAGTCCCTGGCAAAGAAAATCAAATGTCCTGTTATTCCAGGTTCTG
AAGGCATTATTGAAGACGAGAGCGAAGGTTTAAAAATAGCTGAAAAAATA
GGTTTCCCTATTGTTATTAAAGCCGTTGCTGGAGGTGGGGGAAGAGGAAT
TCGTATTGTTAAAGAAAAGGACGAATTCTATAGAGCGTTTTCTGCCGCAC
GTGCAGAAGCCGAAGCCGGTTTTAATAACCCCAATGTTTATATTGAAAAG
TTTATAGAAAATCCAAGGCATTTAGAAATCCAAGTCATTGGGGATACCCA
TGGAAATTATGTGCATTTAGGAGAAAGAGACTGCACCATTCAACGGCGAC
GTCAAAAGTTGATTGAAGAGACTCCTAGTCCCATTCTCAATGCGGAAATC
CGAGTCAAAGTAGGAAAAGTTGCTGTAGATCTAGCAAGAAGCGCCGGATA
TTTTTCTGTTGGAACAGTCGAATTCTTATTAGATAAAGACAAAAAATTCT
ACTTTATGGAAATGAATACCCGAATTCAGGTAGAGCATACCATTACTGAA
GAAGTCACAGGTATAGATCTTGTAAAAGAACAGATTCATGTAGCCATGGG
AAATAAGCTGCCTTGGAAACAAAAGAACATTGAGTTCTCGGGTCATATCA
TCCAATGTCGCATTAACGCTGAGGATCCTACCAATAATTTCTCACCATCT
CCAGGTCGTTTAGATTATTATCTTCCTCCTGCAGGTCCTTCAATTCGTGT
AGATGGAGCTTGTTATAGCGGCTATGCAATCCCTCCTTATTATGATTCTA
TGATAGCAAAGGTAATTGCTAAGGGCAAAAACCGAGAAGAAGCTATAGCT
ATCATGAAACGAGCTTTGAAAGAGTTTCATATCGGTGGTGTGCAGTCTAC
AATACCTTTCCACCAGTTTATGTTGGATAATCCGAAGTTTCTAGAATCTA
ATTACGATATTAACTATATCGATAACCTACTTGCTCAAGGAAATTCTTTT
TTTAAAGAATTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy