Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR149 IGR154 IGR150 IGR153 IGR148 IGR147 IGR151 IGR155 IGR146 CPn0178 CPn0173 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0175 CPn0174 CPn0186 CPn0176 CPn0178 CPn0173 CPn0180 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0175 CPn0174 CPn0186 CPn0176 CPn0173 rpe, - CPn0185 CPn0177 accC, - CPn0182 CPn0179 CPn0181 accB, - CPn0183 efp1, - CPn0184 accB, - CPn0183 efp1, - CPn0184 CPn0178 CPn0180 CPn0179 CPn0181 CPn0174 CPn0186 CPn0176 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0179

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
218403

Gene Stop:
218053

Gene Length:
351

Molecular Weight*:
13031

pI*:
10.30

Net Charge*:
6.90

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LQAGRSGIIPGKKAILLNVNDAKTPNYSCIFESIGFFNEQDLEAQHNQQA
ALVRKILKVVPHHFLKGLIAKLPRSLKKDRKFMSSLIFTKLSYALDLSAP
MHLEGKPNLSYEEKLD$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAAGCAGGCCGTTCTGGAATCATTCCAGGAAAAAAAGCGATCCTCTT
AAATGTAAATGACGCAAAAACTCCTAACTATTCCTGTATTTTTGAATCTA
TAGGGTTCTTTAATGAACAAGACCTTGAAGCACAACACAACCAGCAAGCC
GCGTTAGTGCGAAAGATTTTAAAGGTAGTACCTCATCACTTCTTAAAGGG
ATTGATCGCTAAGTTGCCAAGATCTCTTAAGAAAGACAGAAAGTTCATGT
CCTCCTTAATTTTCACTAAGTTGAGTTATGCTTTAGATCTCTCCGCTCCT
ATGCATCTTGAAGGCAAACCTAACCTTTCTTATGAGGAGAAGTTAGATTG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy