Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR149 IGR150 IGR144 IGR153 IGR148 IGR147 IGR151 IGR146 CPn0178 CPn0173 CPn0180 imdH,guaB, - CPn0172 CPn0177 CPn0170 guaA, - CPn0171 accC, - CPn0182 CPn0175 CPn0174 CPn0176 CPn0178 CPn0173 CPn0180 imdH,guaB, - CPn0172 CPn0177 CPn0170 guaA, - CPn0171 accC, - CPn0182 CPn0175 CPn0174 CPn0176 CPn0173 imdH,guaB, - CPn0172 CPn0177 guaA, - CPn0171 accC, - CPn0182 CPn0179 CPn0181 accB, - CPn0183 accB, - CPn0183 CPn0178 CPn0180 CPn0170 CPn0179 CPn0181 CPn0174 CPn0176 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0176

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
215286

Gene Stop:
216521

Gene Length:
1236

Molecular Weight*:
46013

pI*:
4.90

Net Charge*:
-10.91

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0176 is orthologously related to CT153, a predicted hypothetical protein. Residues 3-409 are 51% similar to CT153.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 364 to 411 (E-value = 4.9e-06) place CPn0176 in the MIR family which is described as MIR domain (PF02815)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
82  
162

PDB Hit:


Gene Protein Sequence:
MDESDGEEASKDSAFSASFSYEFVKSSTRESKNTVTHSTASRTLYILRQD
CSYDPRALKVDDEFRYWVEKRLDAKNPDSLNAFVKEVGTHYVASVTYGGI
GFQVLKMSYLQVEELEKEKISISVAAASSLLKSKTSNATEKGYSSYQSES
SAQTVFLGGTVLPDLQQDKLDFKDWSESIPNEPIPLAISVSSITDLIIPE
LFPSEDAQVLSQKKSALGQVILNYLESHKPKEEGPKPVQITSGFNSSSSV
FTLQAAKAPKTVSFPYIDYWSTIPYLFPTLKETSGAQPLSFYLRFDDIFE
QQNLVHNTSYILASTSVRLGYFGDSYRDYDALSFYGSWPQAYFDWAGYKD
RCTWTLEKLNTTGDLFIRSGDEIRLKHNTSGKYLATTSMSDGYQKLTCTT
QTSDSVFIITV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGATGAATCCGATGGAGAAGAAGCTTCAAAAGATTCTGCATTTTCAGC
TAGTTTTTCCTATGAGTTTGTAAAATCAAGTACTCGAGAATCTAAAAATA
CAGTCACACACTCAACAGCGTCTCGTACATTATATATTTTAAGGCAGGAT
TGTTCTTATGATCCAAGAGCTCTCAAAGTAGATGATGAATTTCGTTATTG
GGTAGAAAAAAGGTTGGACGCCAAGAATCCAGATTCATTAAATGCGTTCG
TTAAAGAGGTAGGAACTCATTATGTCGCGTCAGTGACTTACGGTGGCATT
GGTTTTCAAGTGCTAAAGATGTCTTATCTCCAAGTCGAGGAGTTAGAGAA
AGAAAAAATCTCGATATCTGTAGCTGCAGCAAGTTCTTTATTAAAAAGTA
AAACATCGAACGCGACAGAGAAAGGTTATTCTTCGTATCAGTCGGAATCA
TCAGCTCAAACAGTATTTCTTGGTGGAACAGTATTACCTGATCTCCAGCA
AGACAAGTTGGATTTCAAAGATTGGTCTGAAAGCATTCCTAATGAGCCCA
TTCCTCTAGCTATTAGTGTATCTTCAATTACAGATCTCATAATTCCAGAA
CTTTTCCCTTCTGAAGATGCTCAAGTCTTATCCCAGAAGAAATCAGCTCT
AGGACAAGTTATTCTTAATTATCTAGAGAGTCACAAGCCTAAAGAAGAAG
GCCCAAAACCAGTCCAAATTACTTCTGGATTCAATTCATCGTCTTCGGTA
TTTACGCTTCAAGCAGCAAAAGCTCCTAAGACTGTGTCTTTCCCCTATAT
AGATTATTGGTCTACAATTCCCTATCTTTTCCCCACTCTTAAAGAAACTT
CAGGTGCTCAACCTCTCTCGTTCTACTTGAGGTTTGATGACATCTTTGAG
CAACAAAATTTAGTCCATAATACTTCATATATTTTAGCTTCAACCTCGGT
GAGGTTAGGATATTTCGGAGATTCATATAGAGATTATGATGCTCTATCTT
TCTATGGTAGTTGGCCTCAAGCATATTTTGACTGGGCAGGCTATAAAGAT
AGGTGTACTTGGACCTTAGAAAAACTCAATACAACTGGAGATCTTTTCAT
CCGTTCTGGAGACGAGATACGTTTAAAACACAATACCTCTGGGAAATATC
TTGCTACAACGAGCATGTCTGATGGCTATCAGAAATTAACTTGTACGACA
CAGACGAGTGATTCTGTCTTTATAATTACTGTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy