Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR149 IGR150 IGR144 IGR153 IGR148 IGR147 IGR151 IGR143 IGR146 CPn0178 CPn0173 CPn0180 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 accC, - CPn0182 CPn0175 CPn0174 CPn0176 CPn0178 CPn0173 CPn0180 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 accC, - CPn0182 CPn0175 CPn0174 CPn0176 CPn0173 imdH,guaB, - CPn0172 CPn0177 CPn0170 guaA, - CPn0171 CPn0179 CPn0181 CPn0178 CPn0180 accC, - CPn0182 CPn0169 CPn0179 CPn0181 CPn0174 CPn0176 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0174

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
214257

Gene Stop:
214727

Gene Length:
471

Molecular Weight*:
16950

pI*:
4.30

Net Charge*:
-6.05

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
51
transmembrane  
52  
76
transmembrane  
84  
106
coil-coil  
115  
142

PDB Hit:


Gene Protein Sequence:
MIMTTISNSPSPALNPELSLIPPPTLVSSGTQTSLAYTIPAQGRRSTLRI
ILDIFIIILGLATIISTFIVIFFLNGLNLLSTPSIISSSCLIIVGLLFLI
MGLYFMISSLDQGLVGLLQKELSQAEEREEEYIQEIEALRGAPRAESPTE
SPSTWL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTATGACTACTATATCTAACTCACCCTCCCCTGCATTGAATCCCGA
ACTTTCCCTTATTCCTCCACCAACACTTGTATCTTCAGGTACGCAAACAT
CTCTAGCTTATACGATCCCCGCACAAGGACGAAGATCCACCCTACGTATT
ATATTAGATATATTCATTATCATTCTTGGTTTAGCTACGATCATTTCTAC
CTTTATTGTTATTTTCTTTTTAAATGGGCTGAACTTGCTCTCGACCCCAT
CTATTATCTCTTCGTCATGTTTAATCATTGTTGGATTGCTTTTTTTGATT
ATGGGGTTATATTTCATGATCTCGAGTTTGGATCAGGGGCTTGTAGGCCT
TCTGCAAAAGGAACTCTCTCAAGCCGAAGAAAGAGAAGAAGAGTATATCC
AGGAAATCGAAGCTTTAAGAGGAGCTCCTAGAGCAGAATCTCCCACAGAG
TCTCCTAGTACCTGGTTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy