Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR149 IGR140 IGR142 IGR150 IGR141 IGR144 IGR148 IGR147 IGR151 IGR143 IGR146 CPn0168 CPn0178 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0166 CPn0175 CPn0174 CPn0176 CPn0168 CPn0178 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0166 CPn0175 CPn0174 CPn0176 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0168 CPn0178 CPn0166 CPn0174 CPn0176 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0172

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
imdH  guaB  

Definition:
inosine 5'-monophosphase dehydrogenase

Gene Start:
213177

Gene Stop:
212437

Gene Length:
741

Molecular Weight*:
25704

pI*:
9.50

Net Charge*:
5.10

EC:
1.1.1.205  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Comment:
This sequence may also complement CPn0171, and thus could be described as guaB which carries the EC number 1.6.6.8.

Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to Inosine 5'-monophosphase dehydrogenase sequences; e.g. 1-246 are 99% similar to (AE001604) Inosine 5'-monophosphase dehydrogenase [Chlamydia pneumoniae]; residues 1-246 are 57% similar to (AE000768) inosine monophosphate dehydrogenase [Aquifex aeolicus]; residues 1-246 are 55% similar to IMDH_HAEIN; and residues 2-246 are 56% similar to IMDH_STRPY.
BLAST shows no significant similarities to T.pallidum, C.trachomatis, M.genitalium, or U.ureaplasma.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0516
COG name: IMP dehydrogenase/GMP reductase
Functional Class: F
The phylogenetic pattern of COG0516 is -MTKYQVcEBRHUJ--O--n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 36-237 span seven regions of similarity to blocks BL00487D-H (IMP dehydrogenase / GMP reductase proteins.)

ProDom Summary:  Protein Domain Search
Residues 1-76 are 61% similar to a dehydrogenase biosynthesis domain of O67820_AQUAE.

Residues 145-225 are 59% similar to a defined domain of IMDH_PYRFU.

Residues 77-137 are 65% similar to a defined domain of IMDH_HAEIN.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 1 to 235 (E-value = 9.7e-83) place CPn0172 in the IMPDH family which is described as IMP dehydrogenase / GMP reductase domain (PF00478)

PDB Hit:


Gene Protein Sequence:
VEAGANVLVIDTAHAHSKGVFQTVLEIKSQFPQISLVVGNLVTAEAAVSL
AEIGVDAVKVGIGPGSICTTRIVSGVGYPQITAITNVAKALKNSAVTVIA
DGRIRYSGDVVKALAAGADCVMLGSLLAGTDEAPGDIVSIDEKLFKRYRG
MGSLGAMKQGSADRYFQTQGQKKLVPGGVEGLVAYKGSVHDVLYQILGGI
RSGMGYVGAETLKDLKTKASFVRITESGRAESHIHNIYKVQPTLNY$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAAGCTGGAGCAAATGTTCTAGTCATTGACACAGCTCATGCACACTC
TAAAGGAGTATTCCAAACAGTTTTAGAAATAAAATCCCAGTTCCCACAAA
TTTCTTTAGTTGTAGGGAATCTTGTTACAGCTGAAGCCGCAGTTTCCTTA
GCTGAGATTGGAGTTGACGCTGTAAAGGTAGGTATTGGCCCAGGATCTAT
CTGTACAACTAGAATCGTTTCAGGGGTCGGTTATCCACAAATTACTGCCA
TTACAAACGTAGCAAAAGCTCTTAAAAACTCTGCCGTGACTGTAATTGCT
GATGGGAGAATCCGCTATTCTGGAGATGTGGTAAAAGCATTAGCAGCAGG
AGCAGACTGTGTCATGCTAGGAAGTTTGCTTGCAGGGACTGATGAAGCTC
CTGGGGATATCGTTTCTATCGATGAGAAGCTTTTTAAAAGGTACCGCGGC
ATGGGATCTTTAGGCGCTATGAAACAAGGAAGTGCTGACCGGTATTTTCA
AACACAGGGACAGAAAAAGCTGGTTCCTGGGGGAGTTGAAGGACTAGTCG
CTTATAAAGGCTCTGTCCACGATGTCCTCTATCAAATTTTAGGAGGAATA
CGCTCAGGTATGGGGTATGTTGGAGCTGAAACTCTCAAAGATTTAAAAAC
TAAGGCTTCCTTTGTTCGAATTACTGAATCTGGAAGAGCTGAAAGTCATA
TTCATAATATTTACAAAGTTCAACCAACCTTAAATTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy