Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR149 IGR140 IGR139 IGR142 IGR150 IGR141 IGR144 IGR148 IGR147 IGR143 IGR146 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0166 CPn0175 CPn0174 CPn0165 CPn0176 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0166 CPn0175 CPn0174 CPn0165 CPn0176 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0177 CPn0170 guaA, - CPn0171 CPn0168 CPn0174 CPn0176 CPn0164 CPn0165 CPn0175 CPn0166 CPn0164
* Calculated from Protein Sequence

Gene ID: CPn0171

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
guaA  

Definition:
GMP Synthase

Gene Start:
212435

Gene Stop:
211146

Gene Length:
1290

Molecular Weight*:
48212

pI*:
6.10

Net Charge*:
-6.56

EC:
6.3.5.2  

Functional Class:

Pathway: pathway table
Glutamate metabolism
Purine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to GMP Synthases; e.g. residues 1-429 are 99% similar to (AE001604) GMP Synthase [Chlamydia pneumoniae]; and residues 222-429 and 7-221 are 66% and 41% similar, respectively, to GUAA_ECOLI. Also similar to: GUAA_YEAST, GUAA_SYNY3, GUAA_HELPY, GUAA_BORBU, GUAA_MYCLE, and GUAA_BACSU.
BLAST shows no significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.ureaplyticum.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0519
COG name: GMP synthase - PP-ATPase domain
Functional Class:  F
The phylogenetic pattern of COG0519 is amtkyqvcebrhuj--o--n-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
Residues 82-91 and 169-180 represent blocks BL00442A-B (Glutamine amidotransferases class-I proteins.)

ProDom Summary:  Protein Domain Search
Residues 224-429 are 66% similar to a defined domain of GUAA_ECOLI.

Residues 43-197 are 41% similar to a defined domain of GUAA_SYNY3.

Residues 333-427 are 33% similar to a defined domain of GUAA_CAEEL.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 12 to 197 (E-value = 1e-37) place CPn0171 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)
Residues 309 to 428 (E-value = 1.6e-63) place CPn0171 in the GMP_synt_C family which is described as GMP synthase C terminal domain (PF00958)

PDB Hit:


Gene Protein Sequence:
LQSARRHLNTIFILDFGSQYTYVLAKQVRKLFVYCEVLPWNISVQCLKER
APLGIILSGGPHSVYENKAPHLDPEIYKLGIPILAICYGMQLMARDFGGT
VSPGVGEFGYTPIHLYPCELFKHIVDCESLDTEIRMSHRDHVTTIPEGFN
VIASTSQCSISGIENTKQRLYGLQFHPEVSDSTPTGNKILETFVQEICSA
PTLWNPLYIQQDLVSKIQDTVIEVFDEVAQSLDVQWLAQGTIYSDVIESS
RSGHASEVIKSHHNVGGLPKNLKLKLVEPLRYLFKDEVRILGEALGLSSY
LLDRHPFPGPGLTIRVIGEILPEYLAILRRADLIFIEELRKAKLYDKISQ
AFALFLPIKSVSVKGDCRSYGYTIALRAVESTDFMTGRWAYLPCDVLSSC
SSRIINEIPEVSRVVYDISDKPPATIEWE$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAGAGTGCAAGGAGACATTTGAACACCATATTTATTCTAGATTTTGG
ATCTCAATATACTTATGTATTAGCAAAGCAAGTGCGGAAGTTATTTGTAT
ATTGCGAAGTTCTTCCCTGGAATATCTCTGTGCAATGTTTAAAAGAAAGA
GCGCCTTTGGGGATCATTCTCTCAGGAGGTCCTCACTCTGTCTATGAAAA
CAAGGCTCCACATTTAGATCCTGAAATCTATAAACTTGGCATTCCAATTC
TAGCTATTTGCTATGGCATGCAGCTTATGGCTAGAGATTTTGGAGGGACT
GTAAGCCCTGGTGTAGGAGAATTTGGATATACGCCCATCCATCTGTATCC
TTGTGAGCTCTTCAAACACATCGTCGACTGCGAATCTCTAGACACAGAGA
TTCGGATGAGCCATCGGGATCATGTTACGACAATTCCTGAAGGATTTAAT
GTAATCGCATCCACCTCACAATGCTCGATCTCAGGAATAGAAAATACCAA
ACAACGGTTGTACGGGCTGCAATTTCATCCCGAGGTTTCTGACTCCACTC
CAACGGGAAATAAGATTCTAGAAACTTTTGTTCAAGAGATCTGTTCTGCT
CCCACACTATGGAATCCCTTGTATATTCAGCAAGACCTTGTAAGTAAAAT
TCAAGATACCGTTATTGAAGTATTTGATGAAGTCGCTCAGTCATTAGACG
TACAATGGTTAGCTCAAGGAACCATCTACTCAGATGTTATTGAGTCCTCA
CGCTCTGGACATGCCTCCGAAGTAATAAAATCACATCATAATGTAGGGGG
GCTTCCAAAAAATCTTAAGCTGAAGTTAGTCGAGCCCTTACGTTATTTAT
TTAAAGATGAAGTTCGAATTTTAGGAGAAGCCCTAGGACTTTCTAGCTAT
CTCTTGGACAGGCATCCTTTTCCTGGACCTGGCTTGACAATTCGTGTGAT
TGGAGAGATCCTTCCTGAATATCTAGCCATTTTACGACGGGCGGACCTCA
TCTTTATAGAAGAGCTTAGGAAAGCAAAACTCTACGATAAAATAAGCCAA
GCCTTTGCTCTATTTCTTCCTATAAAATCAGTATCTGTAAAAGGAGATTG
TAGAAGCTATGGTTATACCATAGCATTACGTGCTGTAGAATCTACAGATT
TCATGACAGGACGATGGGCCTACCTTCCATGCGATGTTCTCAGTTCTTGC
TCATCGCGAATTATTAATGAAATACCCGAGGTAAGCCGAGTGGTCTATGA
TATTTCTGACAAGCCACCAGCAACTATAGAATGGGAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy