Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR149 IGR140 IGR139 IGR142 IGR138 IGR141 IGR144 IGR148 IGR137 IGR147 IGR143 IGR146 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0170 CPn0162 guaA, - CPn0171 CPn0166 CPn0163 CPn0175 CPn0174 CPn0165 CPn0176 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0170 CPn0162 guaA, - CPn0171 CPn0166 CPn0163 CPn0175 CPn0174 CPn0165 CPn0176 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0170 CPn0162 guaA, - CPn0171 CPn0168 CPn0176 CPn0164 CPn0163 CPn0165 CPn0174 CPn0164 CPn0166 CPn0175
* Calculated from Protein Sequence

Gene ID: CPn0170

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
211026

Gene Stop:
210022

Gene Length:
1005

Molecular Weight*:
37915

pI*:
7.90

Net Charge*:
4.27

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 36-66 align to block BL00485 (Adenosine and AMP deaminase proteins) with an E-value of 8.3e-05.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MSYDTLFKNLEKEDSVHKICNEIFALVPRLNTIACTEAIIKNLPKADIHV
HLPGTITPQLAWILGVKNGFLKWSYNSWTNHRLLSPKNPHKQYSNIFRNF
QDICHEKDPDLSVLQYNILNYDFNSFDRVMATVQGHRFPPGGIQNEEDLL
LIFNNYLQQCLDDTIVYTEVQQNIRLAHVLYPSLPEKHARMKFYQILYRA
SQTFSKHGITLRFLNCFNKTFAPQINTQEPAQEAVQWLQEVDSTFPGLFV
GIQSAGSESAPGACPKRLASGYRNAYDSGFGCEAHAGEGIETRTIFSSAK
VNPEGLIEITRVTFSSLKRKQPSSLPIRVTCQLG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTTATGATACGTTATTCAAGAATCTTGAAAAGGAAGATTCTGTACA
TAAGATATGCAATGAGATCTTTGCATTAGTACCACGACTCAATACAATCG
CTTGCACCGAAGCTATCATCAAAAACCTCCCCAAAGCAGATATCCATGTA
CACCTTCCTGGGACCATAACACCTCAATTAGCTTGGATTTTAGGTGTGAA
AAATGGGTTCTTAAAATGGTCTTATAATTCTTGGACCAATCATCGATTAC
TTTCTCCTAAGAATCCTCATAAACAATACTCCAATATTTTCCGAAACTTT
CAAGATATCTGTCACGAAAAGGATCCGGATTTAAGTGTATTACAATATAA
TATCTTAAATTACGATTTTAATAGCTTTGATAGAGTGATGGCTACAGTAC
AAGGACATCGCTTTCCTCCTGGAGGAATCCAAAATGAAGAAGACCTTCTT
CTCATTTTCAATAACTATCTCCAGCAATGTCTGGACGATACTATCGTGTA
TACTGAAGTACAACAAAATATCCGCCTTGCCCATGTTTTGTATCCTTCAT
TACCTGAAAAGCACGCGCGTATGAAGTTTTATCAAATCTTGTATCGTGCT
TCGCAAACGTTTTCAAAACACGGGATTACTTTACGATTTTTAAACTGCTT
CAATAAAACATTTGCTCCACAAATAAACACACAAGAACCTGCCCAAGAAG
CTGTTCAATGGCTCCAAGAGGTTGATTCTACATTTCCTGGTCTATTTGTA
GGGATACAATCCGCAGGATCAGAATCTGCGCCCGGAGCCTGTCCTAAGCG
ATTAGCTTCTGGATATAGAAATGCTTATGACTCAGGGTTTGGTTGTGAAG
CTCATGCTGGAGAAGGCATAGAGACCCGGACTATTTTTTCGTCAGCTAAG
GTAAATCCAGAGGGATTGATCGAGATAACCCGAGTGACTTTCTCGTCTCT
TAAACGAAAACAGCCATCTAGTTTACCCATAAGAGTTACTTGCCAGTTAG
GATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy