Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR145 IGR140 IGR139 IGR142 IGR138 IGR141 IGR144 IGR136 IGR137 IGR147 IGR143 IGR146 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0161 CPn0170 CPn0162 guaA, - CPn0171 CPn0166 CPn0163 CPn0165 CPn0168 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0161 CPn0170 CPn0162 guaA, - CPn0171 CPn0166 CPn0163 CPn0165 CPn0173 CPn0167 imdH,guaB, - CPn0172 CPn0169 CPn0161 CPn0170 CPn0162 guaA, - CPn0171 CPn0168 CPn0164 CPn0163 CPn0165 CPn0164 CPn0166
* Calculated from Protein Sequence

Gene ID: CPn0169

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
209501

Gene Stop:
208707

Gene Length:
795

Molecular Weight*:
29924

pI*:
8.70

Net Charge*:
7.30

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of sequences in C.pneumoniae. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Four significant hits to hypothetical proteins in C.pneumoniae:

Residues 6-151 are 51% similar to CPn0164.
Residues 163-264 are 71% similar to CPn0165.
Residues 31-260 are 31% simlilar to CPn0067.
Residues 2-78 are 54% similar to CPn0166.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
92

PDB Hit:


Gene Protein Sequence:
MKNVGSECSQPLVMELNTQPLRNLCESRLVKITSFVIALLALVGGITLTA
LAGAGILSFLPWLVLGIVLVVLCALFLLFSYKFCPIKELGVVYNTDSQIH
QWFQKQRNKDLEKATENPELFGENRAEDNNRSARSQVKETLRDCDGNVLK
KIYERNLDVLLFMNWVPKTMDDVDPVSEDSIRTVISCYKLIKACKPEFRS
LISELLRAMQSGLGLLSRCSRYQERAKTVSHKDAPLFCPTHSYYRDGYLT
PLRAGPRYIINRAI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATGTTGGTTCAGAGTGTTCACAACCATTAGTTATGGAATTAAA
TACCCAGCCATTAAGAAATCTGTGTGAAAGTAGATTAGTGAAGATAACTT
CTTTTGTTATCGCTTTGTTAGCTTTAGTTGGGGGAATTACTCTCACGGCT
TTAGCTGGAGCAGGCATTCTTTCTTTTCTTCCTTGGTTAGTCTTGGGAAT
TGTGCTCGTTGTGCTTTGTGCTTTATTCTTACTTTTTTCATATAAATTCT
GCCCTATAAAAGAGCTAGGGGTTGTCTACAATACCGACTCTCAAATCCAC
CAATGGTTTCAAAAGCAACGAAATAAAGATCTTGAAAAGGCTACGGAAAA
TCCTGAGCTCTTTGGAGAAAATAGGGCGGAAGACAATAATCGCTCTGCAA
GAAGTCAAGTAAAAGAGACTTTACGCGATTGTGATGGAAATGTTTTGAAA
AAGATCTATGAGAGGAATCTAGATGTACTTTTATTTATGAACTGGGTTCC
AAAAACAATGGACGATGTAGATCCAGTATCAGAAGACTCTATACGTACAG
TCATCTCCTGTTATAAGTTAATTAAAGCATGTAAACCTGAATTTCGATCT
CTTATAAGTGAATTACTAAGAGCGATGCAGAGTGGCTTAGGGTTATTAAG
CCGTTGTTCTAGGTATCAAGAGCGAGCTAAAACTGTATCCCATAAAGATG
CACCTCTTTTCTGCCCGACTCATTCTTATTATCGAGATGGCTATCTTACA
CCACTACGAGCAGGACCGCGTTATATTATAAATAGAGCTATATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy