Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR135 IGR140 IGR133 IGR139 IGR142 IGR138 IGR141 IGR144 IGR136 IGR137 IGR134 IGR143 CPn0168 CPn0159 CPn0167 CPn0158 CPn0169 CPn0161 CPn0170 CPn0162 guaA, - CPn0171 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 CPn0168 CPn0159 CPn0167 CPn0158 CPn0169 CPn0161 CPn0170 CPn0162 guaA, - CPn0171 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 Type: tandem, Name:  - 2 CPn0167 CPn0158 CPn0169 CPn0161 CPn0162 guaA, - CPn0171 pfpA, - CPn0160 CPn0168 CPn0159 CPn0170 CPn0164 CPn0163 CPn0165 CPn0164 CPn0166
* Calculated from Protein Sequence

Gene ID: CPn0163

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
206026

Gene Stop:
206397

Gene Length:
372

Molecular Weight*:
13566

pI*:
4.60

Net Charge*:
-5.39

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LRAGGSLVTTYPKEGQRLRSPEQLRVLDDLVQSYPNHLHAIELDCGAIPQ
DLIGATYIITFADFSTYILSLRSYQANSPSDDTWGIWFGSIDDPVQAVIS
FLKDHGFALPSTLAQDPLLCTNK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCGAGCAGGAGGTAGTCTTGTTACAACATACCCTAAGGAAGGTCAGAG
ATTGCGCTCCCCAGAACAGTTAAGAGTTCTGGATGATTTAGTGCAAAGCT
ATCCAAATCACCTACATGCGATTGAACTTGATTGTGGTGCAATCCCTCAA
GATTTGATCGGAGCCACCTATATCATCACGTTCGCCGATTTTTCCACCTA
TATTCTCTCTTTAAGAAGCTACCAAGCCAATTCTCCCTCCGATGATACAT
GGGGGATTTGGTTTGGATCTATTGACGATCCTGTTCAAGCAGTCATATCA
TTTTTAAAAGATCATGGATTTGCTCTTCCCTCGACCTTAGCTCAAGATCC
TTTGCTTTGTACTAACAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy