Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR135 IGR140 IGR133 IGR139 IGR142 IGR138 IGR141 IGR132 IGR136 IGR137 IGR134 IGR143 CPn0168 CPn0159 CPn0167 CPn0157 CPn0158 CPn0169 CPn0161 CPn0170 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 CPn0168 CPn0159 CPn0167 CPn0157 CPn0158 CPn0169 CPn0161 CPn0170 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 Type: tandem, Name:  - 2 CPn0167 CPn0158 CPn0169 CPn0161 CPn0170 CPn0162 pfpA, - CPn0160 CPn0168 CPn0159 CPn0157 CPn0164 CPn0163 CPn0165 CPn0164 CPn0166
* Calculated from Protein Sequence

Gene ID: CPn0162

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
205828

Gene Stop:
204800

Gene Length:
1029

Molecular Weight*:
38855

pI*:
8.70

Net Charge*:
4.55

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical protein sequences in C.pneumoniae. In order of similarity, they are CPn0203, CPn-157, CPn0977, CPn0976, CPn0159, and CPn0978.

Residues 1-255 are 29% similar to residues 1-234 of CPn0203.
Residues 1-159 are 32% similar to residues 1-135 of CPn0157.

Pfam Summary:  Pfam Search
Residues 1 to 342 (E-value = 1.4e-229) place CPn0162 in the DUF648 family which is described as Family of unknown function (DUF648) (PF04890)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
56  
80

PDB Hit:


Gene Protein Sequence:
MKLYSISSDVDTPWIFQLMSKVDSYLFLGGNRIKVVSIVMQEPNLIIGKV
ENVRISTIVKILKILSFLIFPLILIALALHYFLHAKYANHLLVSKILERA
PQYVPIPGRSGDTASHYKLTTLVPVSQKNLQAMGSNPLEVEAALRTTKPS
FFCVPAKYRQIIISSHGIRFSLDLEQLADDINLDSVSWPTEYLNSTMDFC
SKADKRVIQNVQNLRTGTYINSVGKRSLLKFMLQHLFIDGITQENPEALP
NNTSGRLTLFPSVRYIYSHFTPQNPTIWPQVFFRQGPLDEDRGGGFEILE
QLQELGVRFPICPSQGPDNPNFQGFQGIRIYWEDSYQPNKEV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTTTATAGCATCTCTTCAGATGTAGATACACCTTGGATATTTCA
GCTTATGTCAAAGGTAGATTCTTATCTTTTCTTAGGCGGGAATAGAATCA
AGGTTGTATCTATAGTTATGCAAGAACCTAACTTAATTATTGGAAAAGTA
GAAAACGTTCGGATCTCCACAATAGTGAAAATATTAAAGATTTTATCCTT
CTTAATCTTCCCTCTGATTTTAATCGCTTTAGCCCTACACTATTTTCTAC
ATGCTAAATATGCTAATCACTTACTTGTATCTAAGATTTTAGAAAGAGCT
CCTCAGTATGTGCCTATTCCTGGTCGTTCAGGAGACACGGCGTCTCATTA
TAAATTAACAACATTGGTTCCAGTATCCCAAAAAAATCTACAAGCTATGG
GATCAAATCCTCTAGAAGTTGAAGCGGCTCTTCGAACTACAAAACCCTCT
TTTTTCTGTGTACCTGCAAAATACCGTCAGATTATAATTTCAAGTCACGG
CATTCGCTTTTCTTTAGATCTTGAACAACTTGCTGATGACATTAATTTAG
ATTCGGTTTCCTGGCCTACGGAGTATCTTAACTCTACTATGGATTTTTGC
AGCAAGGCAGATAAACGTGTTATACAGAATGTACAAAATCTGCGGACAGG
AACTTACATAAATTCTGTAGGAAAGCGTAGCCTTTTAAAATTCATGTTAC
AGCACCTATTTATTGATGGGATCACACAAGAAAACCCTGAAGCCCTTCCT
AACAATACATCTGGAAGACTGACTCTATTCCCTAGTGTTCGTTATATCTA
TTCTCATTTTACTCCACAAAATCCTACAATATGGCCGCAAGTCTTTTTCA
GACAAGGTCCTCTAGATGAAGATCGAGGAGGAGGATTTGAGATCTTAGAG
CAATTACAAGAGTTAGGAGTTAGGTTTCCAATTTGCCCCTCTCAAGGACC
AGACAATCCTAATTTTCAAGGTTTTCAAGGGATTCGTATCTATTGGGAAG
ATTCCTATCAACCCAATAAGGAGGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy