Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR140 IGR133 IGR139 IGR142 IGR130 IGR138 IGR141 IGR132 IGR131 IGR136 IGR137 IGR129 IGR134 CPn0155 CPn0168 CPn0159 CPn0167 CPn0156 CPn0157 CPn0158 CPn0169 CPn0161 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 CPn0155 CPn0168 CPn0159 CPn0167 CPn0156 CPn0157 CPn0158 CPn0169 CPn0161 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 Type: tandem, Name:  - 2 CPn0167 CPn0156 CPn0158 CPn0169 CPn0161 CPn0162 pfpA, - CPn0160 CPn0155 CPn0168 CPn0159 CPn0157 CPn0164 CPn0163 CPn0165 CPn0164 CPn0166
* Calculated from Protein Sequence

Gene ID: CPn0161

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible a/bhydrolase family protein)

Gene Start:
204622

Gene Stop:
203795

Gene Length:
828

Molecular Weight*:
30749

pI*:
6.00

Net Charge*:
-5.63

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0161 is similar to CT206 and CT149, both conserved hypothetical proteins. Residues 13-271 are 39% similar to CT206 and residues 11-250 are 29% similar to CT0152.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1073
COG name: Hydrolases of the alpha/beta superfamily
Functional Class:  R
The phylogenetic pattern of COG1073 is A---Y-v-EBRh------IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0161 is similar to CPn0152, a conserved hypothetical protein: residues 11-250 are 29% similar to residues 45-293 of CPn0152.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LITGVVLEKHEQRTMFSLTLLNNFTTFGLLHTPLHYNPPYPIVILLHGLA
SDKTGSKRSHVRLAQELTRLGIAALRVDLLGHGDCEGELMDFSLENYKQN
IREIIEYTHSLLHIDQERLAIFGSSLGGTLALQTLPFFNKIKALAVWAPT
ISGELMAAEAQKNAPEVITMSQKGAITYAGMTLNPDFYTQFLKIDIVKEL
MPSARNLPPILYMQGEQDLLVSINHRTLFTEAFANQDKPITILTYPDVDH
AFPFAESSALSDLTQWLKRELTSGE$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATTACAGGCGTGGTATTGGAAAAGCATGAGCAGCGCACCATGTTTTC
ACTGACCCTACTGAATAATTTTACAACTTTTGGCCTTCTACATACTCCTC
TCCATTATAATCCTCCCTATCCTATAGTGATCCTTCTCCATGGTTTAGCT
TCAGATAAAACCGGTTCGAAACGCTCTCATGTCAGGCTAGCTCAGGAACT
CACTCGGTTAGGTATCGCAGCTCTAAGAGTAGATCTCCTTGGTCATGGAG
ACTGTGAGGGTGAGCTTATGGATTTTTCTCTTGAAAATTATAAGCAAAAC
ATTCGTGAAATCATTGAATATACGCATTCCCTACTTCATATAGACCAAGA
AAGGCTCGCTATTTTTGGTTCATCACTCGGAGGAACTCTTGCTCTTCAGA
CTCTTCCTTTTTTTAATAAAATCAAAGCCTTAGCTGTATGGGCGCCTACA
ATTTCAGGAGAATTAATGGCTGCGGAAGCACAAAAAAATGCTCCTGAAGT
GATCACAATGAGTCAAAAAGGCGCCATTACTTATGCTGGGATGACTTTAA
ATCCTGATTTTTATACGCAATTCTTAAAAATAGATATTGTGAAAGAGCTT
ATGCCTAGTGCTCGCAATCTCCCTCCAATTCTTTATATGCAAGGTGAACA
AGATCTTCTGGTTTCTATCAACCACAGAACACTGTTTACCGAAGCATTTG
CAAATCAAGACAAACCAATTACTATTCTTACTTATCCCGATGTCGATCAC
GCGTTTCCTTTTGCCGAATCTTCGGCTCTTTCGGATCTCACGCAATGGTT
AAAAAGAGAATTAACTTCTGGGGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy