Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR133 IGR139 IGR130 IGR138 IGR132 IGR136 IGR131 IGR137 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 kdtA,gseA, - CPn0154 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0166 CPn0163 CPn0165 kdtA,gseA, - CPn0154 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 kdtA,gseA, - CPn0154 CPn0164 CPn0163 CPn0165 CPn0164 CPn0166
* Calculated from Protein Sequence

Gene ID: CPn0160

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pfpA  

Definition:
pyrophosphate-fructose 6-phosphate1-phosphotransferase (alpha or beta subunit?)

Gene Start:
203791

Gene Stop:
202124

Gene Length:
1668

Molecular Weight*:
62373

pI*:
8.60

Net Charge*:
9.51

EC:
2.7.1.11  

Functional Class:
energy metabolism; glycolysis/gluconeogenesis  

Pathway: pathway table
Carbohydrate Metabolism; Fructose and mannosemetabolism Carbohydrate Metabolism; Glycolysis /Gluconeogenesis Carbohydrate Metabolism; Pentose phosphatecycl

Comment:


Blast Summary:  PSI-Blast Search
CPn0160 is similar to TP0542 and TP0108 in T.
pallidum, MG215 in M. genitalium.

CPn0160 is orthologously related to CT207, a predicted pfpA/pfpB? pyrophosphate-fructose 6-phosphate 1-phosphotransferase:
residues 1-536 are 67% similar to CT207.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0205
COG name: 6-phosphofructokinase
Functional Class: G
The phylogenetic pattern of COG0205 is ----YqVCebrh--gpOLIN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0160 is 40% similar to CPn0208, also predicted
Fructose-6phosphate phosphotransferase: residues
34-534 are 40% similar to residues 32-530 of CPn0208.


Pfam Summary:  Pfam Search
Residues 74 to 344 (E-value = 5e-08) place CPn0160 in the PFK family which is described as Phosphofructokinase (PF00365)

PDB Hit:


Gene Protein Sequence:
VELLSLNKSYFEIQRLRYRPEILTLLETIRSKHIQETSSPPSPPPELQKH
IPNLCRIPEVSIYTEQETSSKPLKIGVLLSGGQAPGGHNVVIGLFDALRV
FNPKTRLFGFIKGPLGLTRGLYKDLDISVIYDYYNMGGFDMLSSSREKIK
TEEQKKNILNTVKQLKLDGLLIIGGNNSNTDTAMLAEYFLAHNCKTSVIG
VPKTIDGDLKNCWIETSLGFHTSCRTYSEMIGNLAKDALSAKKYHHFIRL
MGQQASYTTLECGLQTLPNIALISELIATRKISLKQLSEQLALGLVRRYK
SGKNYSTVLIPEGLIEHIFDTRKLIDELNVLLANGDSSIEKILSKLSPET
LKTFHLFPKDIANQLLLARDSHGNVRVSKIATEELLAVMVKKEIEKIKPH
MEFHSVSHFFGYEARAGFPSNFDCNYGIALGIISALFLVRQKTGYMITIN
NLAQSYTEWQGGATPLYKMMHLENRCGTETPVIKTDSVDPKSPAVQHLLQ
QSDSCLVEDLYRFPGPLQYFGKEELIDQRPLTLLWENQTHSPFQALYSTS
GKRSL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGAACTTCTCTCGTTAAATAAAAGTTATTTTGAAATCCAACGCCTTCG
CTACCGCCCTGAGATTCTTACTTTATTAGAAACGATACGTTCGAAACATA
TCCAAGAAACTTCGTCTCCCCCTTCTCCCCCTCCAGAGTTGCAAAAACAC
ATTCCCAATCTATGTCGGATCCCTGAAGTTTCTATTTATACTGAACAGGA
AACGTCATCAAAACCATTAAAGATTGGGGTTTTACTATCAGGAGGACAAG
CTCCTGGGGGGCATAATGTCGTTATTGGTCTTTTTGATGCTTTACGAGTA
TTCAATCCCAAGACTCGCTTATTTGGATTCATCAAAGGACCTTTAGGGCT
TACTCGTGGGCTCTATAAAGATCTGGATATCTCCGTAATCTATGATTATT
ACAACATGGGAGGGTTCGACATGCTCTCCTCAAGCCGAGAAAAAATTAAA
ACTGAAGAGCAGAAAAAAAACATCCTCAACACAGTCAAGCAACTAAAGTT
AGACGGACTACTCATTATAGGAGGAAATAATTCCAATACGGACACTGCGA
TGCTTGCAGAATATTTCCTTGCTCACAACTGCAAAACATCCGTGATTGGA
GTCCCTAAAACTATAGATGGTGATCTTAAGAACTGTTGGATTGAAACCTC
GTTAGGTTTTCATACTTCTTGTCGCACGTACTCAGAAATGATTGGGAATC
TTGCTAAAGATGCTCTTTCTGCAAAAAAATACCACCATTTCATCCGCCTT
ATGGGGCAGCAGGCCTCTTATACTACTTTAGAATGCGGATTGCAGACCCT
CCCTAATATAGCTTTAATTAGCGAACTTATTGCCACTAGGAAAATCTCTT
TAAAGCAACTGAGTGAACAGCTTGCTTTAGGTTTGGTACGCCGCTATAAA
TCTGGAAAAAACTATAGTACTGTGTTAATCCCAGAGGGACTGATTGAGCA
TATTTTCGATACACGCAAGCTTATAGATGAACTCAATGTTTTACTCGCCA
ATGGAGATTCTTCTATTGAAAAAATTCTTTCCAAGCTCTCTCCAGAGACA
TTAAAAACATTTCACTTGTTTCCTAAGGATATTGCGAACCAACTTCTTCT
AGCTCGAGATTCTCATGGAAATGTTAGAGTTTCAAAAATTGCTACAGAAG
AGCTGCTTGCAGTAATGGTAAAGAAGGAAATCGAAAAGATAAAACCCCAT
ATGGAATTCCATTCTGTATCGCATTTTTTTGGTTATGAAGCACGAGCAGG
ATTCCCTTCCAACTTTGATTGTAATTATGGAATCGCTTTAGGGATCATTT
CTGCGTTATTTCTGGTCCGACAAAAGACTGGTTATATGATTACAATCAAT
AATCTTGCTCAATCTTATACTGAATGGCAAGGGGGAGCCACTCCATTATA
TAAGATGATGCACTTAGAAAATCGTTGTGGGACAGAGACTCCTGTTATTA
AAACAGATTCTGTAGACCCAAAATCCCCTGCTGTTCAACATTTACTTCAA
CAAAGTGATTCTTGTTTGGTTGAAGATTTATACCGTTTTCCAGGCCCTTT
ACAGTACTTCGGGAAAGAGGAGCTTATAGATCAACGACCTTTGACCCTGC
TTTGGGAAAATCAAACGCATTCGCCTTTCCAGGCCCTTTACAGTACTTCG
GGAAAGAGGAGCTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy