Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR133 IGR130 IGR138 IGR132 IGR136 IGR131 IGR137 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0163 CPn0164 leuS, - CPn0153 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0163 CPn0164 leuS, - CPn0153 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 CPn0164 leuS, - CPn0153 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154 CPn0163
* Calculated from Protein Sequence

Gene ID: CPn0159

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
201772

Gene Stop:
201464

Gene Length:
309

Molecular Weight*:
11550

pI*:
10.10

Net Charge*:
4.42

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18312. Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Several significant hits to hypothetical proteins in C.pneumoniae.

Residues 1-99 are 54% similar to residues 39-141 of CPn0157.
Residues 1-101 are 47% similar to residues 38-139 of CPn0203.
Residues 12-99 are 34% similar to residues 51-165 of CPn0162.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
25  
42

PDB Hit:


Gene Protein Sequence:
MTPSGFSLATEEKVQVSTAEKVIKILALIFFPIILIALAIRYFLHRKFDR
KCFVIPQDTPKELELILAANPQLVEKAAREVHPGFFALPTKYQSMYIQTS
KG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTCCCTCTGGGTTTTCTTTAGCTACTGAAGAAAAAGTACAGGTCTC
AACAGCAGAAAAAGTTATAAAGATCCTTGCTCTGATCTTCTTCCCGATCA
TTTTAATCGCTCTGGCTATCCGCTACTTCTTACATAGAAAATTCGATAGA
AAATGCTTCGTTATCCCTCAAGACACGCCTAAAGAACTGGAGCTAATTCT
TGCAGCAAATCCTCAATTAGTTGAAAAAGCAGCTCGAGAGGTCCACCCAG
GTTTCTTTGCCCTACCTACAAAATACCAAAGTATGTACATCCAAACTTCT
AAAGGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy