Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR133 IGR130 IGR132 IGR136 IGR131 IGR137 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0163 leuS, - CPn0153 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0163 leuS, - CPn0153 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 CPn0163 leuS, - CPn0153 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0158

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
201430

Gene Stop:
200891

Gene Length:
540

Molecular Weight*:
20569

pI*:
5.00

Net Charge*:
-6.13

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18311. Note no similarity to C.trachomatis, but ProDom results reveal similarity to C. psittaci.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 11-178 are 30% similar to a defined domain of Q46223_CHLPS, defined as: KDO-transferase.

Paralogs:  Local Blast Search
Two significant hits to hypothetical proteins in C.pneumoniae.

Residues 2-166 are 28% similar to residues 177-336 of CPn0162.
Residues 1-66 are 37% similar to residues 153-216 of CPn0203.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LLLEDLDTDSIPWPKLYLSEDFDFAYYPESKAIIDTVAKLEKNNPGEEFC
LESKKILARYLLEQLFKLETGLNFPTSTIDGGRESFLIEFSHETKKPTVW
AFIYFYYYHSNGPKLEKDFKQAGCEVHNRLLNLGLKYRPQAGAQNDGRNG
GPYGPIGFLIVWEENYGSVLKDHGFIKDN$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCTCTTAGAGGACTTAGATACAGATTCTATACCATGGCCTAAACTCTA
TTTGAGTGAGGATTTTGATTTTGCCTATTATCCCGAAAGCAAGGCTATAA
TTGATACAGTTGCTAAACTTGAAAAGAATAATCCTGGCGAGGAGTTTTGT
TTAGAAAGCAAGAAAATCTTGGCACGTTATCTCTTAGAACAACTCTTTAA
GCTCGAAACCGGATTGAACTTTCCTACATCCACTATTGATGGAGGTAGAG
AATCTTTCTTAATCGAGTTCAGTCATGAAACTAAAAAACCCACTGTATGG
GCCTTCATTTATTTTTATTACTACCATTCTAACGGCCCCAAACTAGAAAA
GGATTTTAAACAAGCAGGCTGCGAAGTCCATAATAGGCTCTTAAACCTTG
GATTAAAATATAGACCACAAGCAGGCGCTCAAAATGACGGGCGTAATGGA
GGTCCATATGGACCTATAGGATTCCTTATAGTTTGGGAAGAAAACTATGG
ATCTGTGTTGAAGGATCATGGATTTATCAAAGACAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy