Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR133 IGR130 IGR132 IGR136 IGR131 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 leuS, - CPn0153 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 leuS, - CPn0153 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0161 CPn0162 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 leuS, - CPn0153 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0157

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
200723

Gene Stop:
200295

Gene Length:
429

Molecular Weight*:
15909

pI*:
10.40

Net Charge*:
6.94

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those to C.pneumoniae sequences. No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous significant hits of hypothetical protein sequences in C.pneumoniae. In order of similarity these are: CPn0203, CPn0159, CPn0162, CPn0977, CPn0978, and CPn0976.

Residues 1-142 are 43% similar to CPn0203.
Residues 39-141 are 54% similar to CPn0159.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
62  
79

PDB Hit:


Gene Protein Sequence:
MNIYQFSPGASPNWQASLMAQLNSYFCLGGETVTRIISLRPSGLILAKKE
KAVVSTAEKILKILSFILFPLVLIALAIRYLLYNKFNKDLDRAVFFIPTE
ITKAEELIIAKNPALVKEAALTVSPLFYSLPKKYQLMKVETP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACATATACCAATTTTCTCCTGGAGCTTCCCCTAATTGGCAAGCTTC
GTTGATGGCTCAGCTGAACTCCTATTTTTGTTTAGGAGGAGAGACTGTGA
CGCGCATTATTTCTCTTCGACCCTCCGGACTTATCTTGGCTAAAAAAGAG
AAGGCTGTTGTTTCTACAGCAGAAAAAATTTTAAAAATCCTTTCCTTTAT
CCTGTTTCCTCTAGTCTTGATAGCTCTAGCGATACGCTACCTCTTATATA
ACAAGTTTAATAAAGATTTGGATCGAGCAGTATTTTTTATCCCCACAGAA
ATTACTAAAGCCGAAGAACTGATCATTGCCAAAAATCCTGCGCTAGTGAA
AGAAGCGGCTCTAACTGTTTCTCCGCTCTTCTATTCTCTTCCTAAGAAAT
ATCAACTTATGAAAGTTGAAACTCCTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy