Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR135 IGR133 IGR130 IGR132 IGR128 IGR136 IGR131 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0152 CPn0162 pfpA, - CPn0160 leuS, - CPn0153 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0161 CPn0152 CPn0162 pfpA, - CPn0160 leuS, - CPn0153 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0152 CPn0162 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 CPn0161 leuS, - CPn0153 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0156

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
200117

Gene Stop:
199767

Gene Length:
351

Molecular Weight*:
13069

pI*:
6.80

Net Charge*:
-0.43

EC:
 

Functional Class:
unknown; Chlamydia pneumoniae-specific proteins  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AE001603. Paralog found in PSI-BLAST search and did not appear in search of cppro database. Appears to be C. pneumoniae-specific.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Residues 1-116 are 94% similar to residues 52-167 of (X80061) KDO-transferase [Chlamydia pneumoniae].

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
MMHNIVVLSEEPGRSAFLGRTAFFPNKYPIAQGGVGIPSTIGNLFTIWYC
FYFYRAATPQSDHPDGCGFILLERLKELGAGFFYCDLRESNTTGFTLFFE
GSNKGVLKNHLFIRDE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGCACAATATTGTTGTTCTTAGTGAGGAACCTGGACGAAGCGCTTT
TCTTGGTAGGACGGCATTTTTCCCTAATAAGTATCCAATAGCTCAGGGTG
GTGTTGGAATACCATCTACAATAGGCAATCTCTTTACTATATGGTACTGT
TTCTATTTTTATAGAGCTGCAACTCCACAATCTGATCATCCTGACGGATG
TGGCTTTATTCTACTAGAAAGGCTTAAGGAGCTCGGTGCAGGGTTCTTTT
ATTGTGATCTTCGTGAGTCCAATACCACTGGCTTTACTCTTTTTTTTGAA
GGCTCCAATAAAGGTGTGTTAAAGAATCACTTGTTTATTAGAGATGAGTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy