Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR133 IGR130 IGR132 IGR128 IGR127 IGR131 IGR129 IGR134 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0152 mhpA, - CPn0151 pfpA, - CPn0160 leuS, - CPn0153 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0152 mhpA, - CPn0151 pfpA, - CPn0160 leuS, - CPn0153 Type: tandem, Name:  - 2 CPn0156 CPn0158 CPn0152 mhpA, - CPn0151 pfpA, - CPn0160 CPn0155 CPn0159 CPn0157 leuS, - CPn0153 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0154

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
kdtA  gseA  

Definition:
3-deoxy-D-manno-2-octulosonic acid (Kdo) transferase

Gene Start:
197892

Gene Stop:
199205

Gene Length:
1314

Molecular Weight*:
49175

pI*:
9.90

Net Charge*:
15.29

EC:
2.-.-.-  

Functional Class:
cell envelope; surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table

Comment:
This enzyme, typically seen in gram-negative bacteria, adds Kdo (3-deoxy-D-manno-
octulosonic acid) to lipid A precursors, thereby conferring genus-specific
epitopes to LPS (see Belunis et al., JBC 267:18702,1992; Mamat et al.
Microb. Pathog. 17:87,1994).

Blast Summary:  PSI-Blast Search
CPn0154 is similar to CT208, a predicted gseA/kdtA 3-deoxy-D-manno-2-octulosonic acid:
residues 14-435 are 52% similar to CT208. No similarity to T.pallidum,
M.genitalium or U.urealyticum.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1519
COG name: 3-Deoxy-D-manno-octulosonic-acid transferase (LPS biosynthesis)
Functional Class:  M
The phylogenetic pattern of COG1519 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
Residues 39 to 232 (E-value = 4.8e-99) place CPn0154 in the Glycos_transf_N family which is described as 3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase) (PF04413)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
33
transmembrane  
110  
128
transmembrane  
305  
322

PDB Hit:


Gene Protein Sequence:
MMLRGVHRIFKCFYDVVLVCAFVIALPKLLYKMLVYGKYKKSLAVRFGLK
KPHVPGEGPLVWFHGASVGEVRLLLPVLEKFCEEFPGWRCLVTSCTELGV
QVASQVFIPMGATVSILPLDFSIIIKSVVAKLRPSLVVFSEGDCWLNFIE
EAKRIGATTLVINGRISIDSSKRFKFLKRLGKNYFSPVDGFLLQDEVQKQ
RFLSLGIPEHKLQVTGNIKTYVAAQTALHLERETWRDRLRLPTDSKLVIL
GSMHRSDAGKWLPVVQKLIKEGVSVLWVPRHVEKTKDVEESLHRLHIPYG
LWSRGANFSYVPVVVVDEIGLLKQLYVAGDLAFVGGTFDPKIGGHNLLEP
LQCEVPLIFGPHITSQSELAQRLLLSGAGLCLDEIEPIIDTVSFLLNNQE
VREAYVQKGKVFVKAETASFDRTWRALKSYIPLYKNS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGCTACGAGGTGTCCATCGTATTTTTAAGTGTTTCTACGATGTTGT
TTTAGTTTGTGCATTTGTAATTGCCTTACCTAAGCTTCTTTATAAGATGT
TAGTTTATGGTAAGTATAAGAAATCTCTAGCAGTTCGTTTTGGTCTGAAA
AAGCCGCATGTCCCTGGAGAAGGGCCTTTGGTGTGGTTTCATGGAGCATC
TGTAGGGGAAGTTCGTTTGCTTCTACCTGTACTTGAAAAATTTTGTGAAG
AATTTCCAGGTTGGCGTTGTCTAGTGACTTCATGTACAGAACTTGGAGTG
CAGGTGGCAAGCCAAGTGTTTATTCCTATGGGAGCCACTGTTTCAATACT
GCCTTTGGATTTTAGCATAATTATCAAATCGGTAGTCGCTAAACTGCGTC
CCTCCCTTGTAGTCTTTTCTGAAGGGGACTGCTGGCTAAATTTTATTGAG
GAAGCAAAACGTATAGGAGCAACTACTCTCGTCATTAATGGTAGAATTTC
CATAGATTCTTCAAAGCGTTTTAAATTTTTAAAGCGCCTAGGTAAAAACT
ATTTCTCTCCAGTAGATGGATTTTTATTACAGGACGAAGTCCAAAAACAG
CGTTTTCTTTCTTTAGGGATACCTGAACATAAATTGCAGGTTACAGGGAA
TATTAAGACCTATGTAGCAGCACAGACAGCACTGCACTTAGAAAGGGAAA
CTTGGAGAGATCGTTTGAGATTGCCAACGGACTCGAAATTAGTAATCCTA
GGTTCTATGCATAGAAGTGATGCAGGAAAATGGCTTCCTGTAGTGCAGAA
ATTAATAAAAGAGGGGGTCTCAGTTTTATGGGTGCCAAGACACGTTGAAA
AGACCAAGGATGTTGAAGAATCTTTGCATCGGTTGCACATTCCTTATGGG
TTGTGGAGCCGCGGCGCCAATTTTTCTTATGTACCAGTTGTCGTTGTTGA
TGAAATTGGCTTATTGAAACAACTTTATGTTGCTGGTGATTTAGCATTTG
TTGGAGGTACTTTCGATCCTAAGATCGGAGGACATAATTTATTAGAACCT
CTCCAATGTGAAGTCCCTTTAATTTTTGGTCCACATATTACATCGCAATC
AGAGCTTGCGCAACGCCTGTTGCTTTCTGGTGCAGGACTTTGTTTAGACG
AAATAGAGCCTATAATCGATACAGTTTCTTTCTTACTAAATAATCAAGAA
GTGCGTGAGGCTTATGTACAGAAGGGAAAAGTGTTCGTAAAAGCAGAAAC
AGCTTCCTTTGACCGTACATGGAGAGCATTAAAAAGTTATATTCCCTTGT
ACAAAAATAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy