Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR133 IGR130 IGR132 IGR128 IGR127 IGR126 IGR131 IGR129 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0155 CPn0159 CPn0156 CPn0157 CPn0158 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0156 CPn0158 CPn0152 mhpA, - CPn0151 CPn0155 CPn0159 CPn0157 leuS, - CPn0153 CPn0150 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0153

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
leuS  

Definition:
leucyl-tRNA synthetase

Gene Start:
195433

Gene Stop:
197895

Gene Length:
2463

Molecular Weight*:
93961

pI*:
5.50

Net Charge*:
-18.98

EC:
6.1.1.4  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of Macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Cellular location of the leucyl-tRNA synthetase is cytoplasmic. It appears to be a monomer.
Reaction: ATP + l-leucine + tRNA(leu) = AMP + pyrophosphate + l-leucyl-tRNA(leu).
Through similarity the leucyl-tRNA synthetase belongs to class-I aminoacyl-tRNA synthetases.


Blast Summary:  PSI-Blast Search
CPn0153 is orthologously related to CT209: residues 1-820 of CPn0153 are 73% similar to residues 1-819 of CT209, a predicted leucyl-tRNA synthetase from C. trachomatis.
CPn0153 is also similar to TP0586, UU371, MG266, CT302, UU267, MG345, CT019 (all predicted tRNA synthetases)

COGS Summary:  COGS Search
BeTs to 13 clades of COG0495
COG name: Leucyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0495 is amtkYQvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0153 is paralogous to CPn0094: residues 15-737 of CPn0153 are 23% similar to residues 22-741 of CPn0094, both predicted tRNA synthetases.

Pfam Summary:  Pfam Search
Residues 11 to 641 (E-value = 7e-126) place CPn0153 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)

PDB Hit:


Gene Protein Sequence:
MRYDPNLIEKKWQQFWKEHRSFQANEDEDKVKYYVLDMFPYPSGAGLHVG
HLIGYTATDIVARYKRARGFSVLHPMGWDSFGLPAEQYAIRTGTHPKVTT
QKNIANFKKQLSAMGFSYDEGREFATSDPDYYHWTQKLFLFLYDQGLAYM
ADMAVNYCPELGTVLSNEEVENGFSIEGGYPVERKMLRQWILKITAYADK
LLEGLDALDWPENVKQLQKNWIGKSEGALVTFHLTQEGSLEAFTTRLDTL
LGVSFLVIAPEHPDLDSIVSEEQRDEVTAYVQESLRKSERDRISSVKTKT
GVFTGNYAKHPITGNLLPVWISDYVVLGYGTGVVMGVPAHDERDREFAEM
FSLPIHEVIDDNGVCIHSNYNDFCLNGLSGQEAKDYVINYLEMRSLGRAK
TMYRLRDWLFSRQRYWGEPIPIIHFEDGTHRPLEDDELPLLPPNIDDYRP
EGFGQGPLAKAQDWVHIYDEKTGRPGCRETYTMPQWAGSCWYYLRFCDAH
NSQLPWSKEKESYWMPVDLYIGGAEHAVLHLLYSRFWHRVFYDAGLVSTP
EPFKKLINQGLVLASSYRIPGKGYVSIEDVREENGTWISTCGEIVEVRQE
KMSKSKLNGVDPQVLIEEYGADALRMYAMFSGPLDKNKTWSNEGVGGCRR
FLNRFYDLVTSSEVQDIEDRDGLVLAHKLVFRITEHIEKMSLNTIPSSFM
EFLNDFSKLPVYSKRALSMAVRVLEPIAPHISEELWVILGNPPGIDQAAW
PQIDESYLVAQTVTFVVQVNGKLRGRLEVAKEAPKEEVLSLSRSVVAKYL
ENAQIRKEIYVPNKLVNFVL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGATATGACCCCAACTTAATAGAAAAAAAATGGCAACAATTTTGGAA
AGAACATCGAAGCTTTCAAGCAAATGAAGACGAGGATAAAGTAAAATATT
ATGTTTTAGACATGTTCCCTTATCCTTCAGGAGCAGGTCTACATGTAGGC
CACCTTATTGGCTATACAGCGACAGATATTGTTGCGAGATATAAAAGAGC
ACGGGGATTCTCAGTTCTTCATCCTATGGGCTGGGATAGCTTTGGTTTGC
CCGCAGAACAATATGCGATTCGGACAGGAACCCATCCTAAAGTCACGACC
CAGAAGAATATCGCTAATTTTAAAAAACAGCTCTCCGCTATGGGATTTTC
GTATGATGAAGGACGAGAATTTGCTACGAGTGATCCCGACTATTATCATT
GGACTCAGAAACTTTTCCTTTTTCTTTATGATCAAGGACTCGCCTATATG
GCCGACATGGCAGTGAACTACTGTCCAGAACTTGGTACCGTATTATCGAA
TGAAGAAGTTGAAAATGGATTCTCAATAGAAGGGGGATATCCTGTAGAGC
GGAAAATGCTTCGTCAGTGGATTCTCAAAATCACAGCATATGCCGATAAG
TTATTAGAAGGTCTCGATGCCCTAGATTGGCCCGAAAATGTAAAGCAGTT
ACAGAAAAATTGGATAGGGAAATCTGAAGGGGCTCTCGTAACATTTCATT
TGACGCAAGAGGGCAGTCTAGAAGCCTTCACTACCCGCCTAGACACTTTA
TTAGGGGTGAGTTTCTTAGTGATTGCTCCTGAGCACCCAGATTTAGATTC
TATAGTGAGTGAAGAGCAAAGAGACGAAGTCACAGCCTATGTACAAGAGA
GTCTCAGGAAAAGTGAACGAGATCGCATTAGCTCTGTTAAGACAAAAACA
GGGGTCTTTACAGGAAACTATGCCAAGCACCCCATTACAGGGAACCTTTT
ACCTGTTTGGATTTCAGATTATGTCGTCTTAGGCTATGGCACAGGCGTAG
TTATGGGAGTCCCAGCGCATGACGAGAGAGATCGAGAGTTTGCTGAAATG
TTTTCTCTTCCGATTCATGAGGTGATTGATGATAACGGGGTTTGTATTCA
TAGCAATTACAACGACTTTTGTCTTAATGGCTTGTCTGGGCAAGAAGCTA
AAGATTATGTAATCAACTACCTGGAGATGCGTTCTCTCGGAAGAGCTAAG
ACTATGTACAGGCTGCGAGACTGGCTCTTCTCTAGACAGAGATATTGGGG
AGAGCCTATCCCCATCATTCATTTTGAAGATGGAACGCACCGTCCTTTAG
AAGATGATGAGCTGCCTCTTCTCCCTCCGAATATTGATGACTATCGTCCC
GAAGGATTCGGTCAGGGTCCTTTAGCGAAGGCTCAAGATTGGGTGCATAT
CTACGACGAGAAGACAGGTAGACCAGGATGTAGAGAGACTTATACTATGC
CACAGTGGGCAGGCTCTTGCTGGTATTATCTTCGTTTCTGTGATGCACAC
AACTCTCAGTTGCCTTGGAGTAAAGAAAAAGAAAGCTATTGGATGCCTGT
AGATCTTTACATTGGAGGTGCAGAACACGCTGTTCTTCATCTTCTTTACT
CGAGATTTTGGCATCGAGTCTTCTATGACGCGGGTCTTGTCTCAACACCA
GAACCTTTTAAGAAACTGATCAACCAGGGACTTGTGTTAGCCTCTTCATA
CCGAATTCCTGGTAAGGGATACGTAAGCATAGAAGACGTTAGGGAAGAAA
ATGGAACGTGGATCTCAACTTGTGGAGAGATTGTGGAAGTTAGACAAGAG
AAAATGTCTAAATCGAAACTCAATGGTGTGGATCCTCAGGTTTTGATTGA
AGAGTATGGTGCAGATGCCTTACGTATGTACGCTATGTTTTCGGGACCCT
TGGATAAAAATAAAACCTGGTCCAATGAAGGTGTTGGGGGGTGCCGTCGT
TTCCTAAATCGTTTTTATGATTTGGTGACTTCGTCAGAGGTTCAAGATAT
AGAAGACCGTGACGGGCTGGTTCTCGCTCACAAATTGGTGTTTAGGATTA
CAGAACATATTGAAAAAATGTCTTTGAATACCATACCGTCTTCATTTATG
GAATTTCTGAACGATTTTTCAAAGCTTCCAGTCTATTCTAAACGTGCCTT
GTCTATGGCTGTTCGTGTATTGGAGCCTATAGCTCCGCATATCAGCGAAG
AGTTATGGGTTATATTGGGAAACCCACCAGGGATTGATCAAGCAGCATGG
CCTCAAATAGACGAGAGTTACCTAGTTGCTCAAACTGTGACTTTTGTTGT
TCAGGTTAATGGGAAGTTACGAGGACGTCTCGAGGTAGCCAAAGAAGCTC
CTAAAGAAGAAGTTTTATCTTTGTCTCGAAGTGTAGTTGCAAAGTATCTA
GAGAACGCTCAAATACGAAAAGAAATTTATGTTCCTAATAAACTAGTGAA
TTTTGTCCTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy