Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Met_2 tRNA_Met_3 IGR130 IGR128 IGR127 IGR126 IGR129 CPn0155 CPn0156 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0155 CPn0156 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0156 CPn0152 mhpA, - CPn0151 CPn0155 leuS, - CPn0153 CPn0150 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0152

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (possible a/b hydrolase fold member)

Gene Start:
195265

Gene Stop:
194315

Gene Length:
951

Molecular Weight*:
34304

pI*:
6.30

Net Charge*:
-3.92

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0152 is orthologously related to CT149, a conserved hypothetical protein: residues 1-316 are 46% similar to CT149.

CPn0152 is weakly similar to CT206, a hypothetical protein.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1073
COG name: Hydrolases of the alpha/beta superfamily
Functional Class:  R
The phylogenetic pattern of COG1073 is A---Y-v-EBRh------IN-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0152 is weakly similar to CPn0161, a predicted acyltransferase: residues 45-293 are 29% similar to residues 11-250.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
20

PDB Hit:


Gene Protein Sequence:
MRKVAFLVSCLFSVAIGASAAPVRVPGFPQIPEDLVQIKTEVCPKQEVCL
AVTIKCDDHNLIGVLHLPNTPTPEGGFPTVVLFHGFRGTKFGGLTGAYRK
LGRKFAAVGIATLRVDMAGCGDSEGVAEEVPIETYLRDAQTILETVQEHP
DLNAYRLGISGFSLGCHIAFELAKIYNPRDLNIKALSVWAPIADGGILLK
ELYENFSKHGEGDIISVGKDFGFGPPPIIVCSGDVDLLIRIQDHVTANSL
PTKPYILHQQGIDDTLVSRTQQTLFKNTAPGRMTFISYPNTGHNLATAPD
LDMILDQIVSHFQRTL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTAAAGTTGCTTTTTTAGTTTCTTGCCTATTTTCAGTAGCTATAGG
GGCTTCGGCAGCTCCAGTCCGTGTTCCGGGATTTCCTCAAATTCCAGAAG
ATCTCGTTCAAATCAAGACAGAAGTATGTCCGAAGCAAGAAGTATGTTTA
GCAGTTACTATCAAATGTGACGATCACAATCTTATTGGTGTTTTACATCT
TCCTAACACTCCCACACCGGAAGGAGGGTTCCCTACAGTCGTGTTGTTTC
ACGGCTTCCGAGGAACAAAATTCGGAGGTTTAACTGGAGCCTATCGAAAA
TTAGGAAGAAAATTCGCTGCAGTTGGAATTGCCACTTTACGTGTCGACAT
GGCCGGATGTGGAGATAGTGAAGGAGTTGCTGAAGAAGTTCCTATAGAGA
CCTATTTACGTGATGCACAAACCATACTTGAAACTGTCCAAGAACACCCA
GATCTCAATGCATATCGTCTAGGAATTTCAGGTTTTTCTTTAGGATGCCA
CATAGCTTTCGAGTTGGCTAAAATCTATAACCCAAGAGACTTAAATATCA
AAGCCCTGAGTGTATGGGCTCCAATTGCAGATGGGGGCATCTTATTAAAA
GAGCTCTATGAGAATTTCTCTAAACACGGCGAAGGAGATATTATCTCTGT
TGGGAAGGACTTTGGATTTGGTCCTCCTCCTATAATTGTTTGCTCTGGCG
ATGTTGATCTCCTCATACGCATCCAAGATCACGTTACAGCAAATTCCCTA
CCCACAAAACCCTATATTTTGCATCAACAAGGCATTGATGACACTCTTGT
TTCTAGGACACAACAGACACTATTTAAAAACACAGCTCCCGGAAGAATGA
CTTTCATCTCTTACCCTAACACAGGACACAACTTAGCCACAGCTCCTGAT
TTAGATATGATCTTAGATCAAATTGTGAGCCACTTCCAACGAACACTTTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy