Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR128 IGR127 IGR126 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 CPn0152 mhpA, - CPn0151 leuS, - CPn0153 CPn0150 kdtA,gseA, - CPn0154 kdtA,gseA, - CPn0154
* Calculated from Protein Sequence

Gene ID: CPn0151

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mhpA  

Definition:
monooxygenase

Gene Start:
194142

Gene Stop:
192622

Gene Length:
1521

Molecular Weight*:
58342

pI*:
8.50

Net Charge*:
9.75

EC:
1.14.13.-  

Functional Class:
uncategorized  

Pathway: pathway table
Metabolism of cofactors, vitamins, and oOther substances; ubiquinonebiosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Cpn0151 is orthologously related to CT148: residues 1-506 of CPn0151 are 57% similar to residues 1-507 of CT148, a predicted monooxygenase from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
242  
333

PDB Hit:


Gene Protein Sequence:
MADILVIGANPTGLILANMLIQHGISVKVIDHRASPEDPSFLDCRKLPVI
LSCSSLELLHNSEMLGDFIQANHKIFGARYHWKKRTLLFKFSQATDSPVP
FSLSTTYQSLEQHLIDEFLKRGGVIDWSTRPVTLVDNSIFIESTKVSQNF
ENREIYNPKWIIACEADNNLDIRDLVKSQLRARRINREVIFINCDEGEPF
EEDHIHLLPITKNFLNFVFYNPQEKTKQLCLPQGTHSISPKLKQKLLYTY
NLVISDENFHIKTSHHAFPPEHGNVLFLGSLSNTLLLSYLNGINTNIHAA
FNLAWKLLPVLKKAALKHLVITKEQEDGNILPYISPTTEKRAKKLPFSRF
YTPALMYYFLKGCRKFNTTGEEYYYPPHQALKYRSSDIIKMSPQDKEIHG
PGPGMRAIDARLENGSFLLDPLKSSKHLLIFFKDIPDLKEALQEEYGEWI
EICNVKEPRILNLYHANPNSLFIIRPDRYIGYRTHTFKLHELISYLLRIF
ASEKTS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAGACATTTTAGTCATAGGTGCTAATCCTACAGGTCTCATTTTGGC
AAATATGCTAATACAACATGGGATCTCTGTAAAAGTTATCGACCACAGAG
CTTCTCCTGAGGATCCTAGCTTCTTAGATTGTCGTAAGCTCCCTGTAATC
TTGTCTTGCTCTTCCTTGGAGCTTCTTCACAATAGTGAAATGCTAGGCGA
TTTTATCCAAGCCAACCATAAGATCTTTGGTGCGCGTTACCATTGGAAAA
AGAGAACCTTATTATTTAAGTTCAGCCAAGCAACGGACTCTCCAGTTCCT
TTTTCTCTATCAACAACATATCAAAGTTTAGAACAGCACCTAATTGACGA
GTTTCTAAAACGCGGAGGCGTCATAGATTGGTCGACACGCCCCGTAACTC
TAGTTGATAACAGTATCTTTATTGAAAGTACTAAAGTATCACAAAATTTT
GAAAATCGTGAGATCTACAATCCAAAGTGGATTATAGCCTGTGAGGCTGA
CAACAACCTAGACATCAGGGATCTTGTCAAAAGCCAGCTGAGAGCACGTA
GAATAAATCGAGAAGTTATTTTTATCAATTGCGATGAGGGCGAGCCCTTT
GAAGAAGATCATATCCATCTTCTTCCCATCACAAAGAACTTCTTAAATTT
CGTTTTCTATAATCCCCAGGAAAAAACGAAACAGCTCTGTCTACCCCAAG
GAACGCATTCCATATCACCGAAACTTAAACAGAAGCTACTTTATACTTAC
AATCTCGTCATCTCTGATGAAAATTTCCATATAAAAACAAGTCACCACGC
ATTCCCTCCTGAACATGGAAATGTATTATTTTTAGGTAGCCTCTCTAATA
CTCTGCTTCTTTCTTATCTCAACGGTATTAATACCAATATTCACGCAGCC
TTTAATCTCGCTTGGAAGCTACTTCCTGTATTGAAAAAAGCTGCATTAAA
ACATTTGGTGATTACAAAAGAACAGGAAGATGGCAATATCCTACCTTATA
TTAGTCCTACTACGGAAAAGCGCGCGAAGAAACTCCCATTTTCTCGCTTC
TATACACCTGCTTTGATGTACTACTTTTTAAAGGGATGTCGAAAGTTTAA
TACTACAGGAGAAGAGTATTACTACCCCCCTCACCAAGCACTGAAATACC
GTTCTAGCGATATTATCAAAATGTCTCCTCAAGATAAGGAAATCCATGGT
CCTGGTCCAGGAATGAGAGCTATAGATGCTCGCCTAGAAAACGGTTCTTT
CCTCTTAGATCCTTTAAAAAGTAGTAAGCACCTTCTTATCTTTTTTAAAG
ATATCCCCGACTTAAAGGAAGCTCTACAAGAAGAATATGGCGAATGGATA
GAGATTTGCAATGTTAAGGAACCTCGAATCCTTAACCTCTATCACGCAAA
TCCAAATTCGCTATTTATTATCCGCCCCGATCGTTATATCGGATATAGAA
CACATACCTTTAAGCTGCACGAGCTGATCTCATATCTACTTAGAATTTTT
GCCAGCGAAAAGACCAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy