Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR125 IGR127 IGR126 CPn0152 mhpA, - CPn0151 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150 CPn0152 mhpA, - CPn0151 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150 CPn0152 mhpA, - CPn0151 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150
* Calculated from Protein Sequence

Gene ID: CPn0150

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
187834

Gene Stop:
192447

Gene Length:
4614

Molecular Weight*:
173811

pI*:
6.80

Net Charge*:
-4.40

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum or U. urealyticum sequences.

CPn0150 is similar to CT147, a hypothetical protein: residues 26-1440 are 22% similar to CT147.

CPn0150 is also weakly similar to AE000718 in Aquifex aeolicus and to human CENP-E protein.

COGS Summary:  COGS Search
BeTs to 4 clades of COG1196
COG name: Chromosome segregation ATPases
Functional Class:  D
The phylogenetic pattern of COG1196 is am-kYqvc-br---gpol---
Number of proteins in this genome belonging to this COG is 6

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
542  
569
coil-coil  
583  
645
coil-coil  
672  
710
coil-coil  
814  
841
non-globular  
844  
916
coil-coil  
1006  
1033
coil-coil  
1221  
1259
coil-coil  
1383  
1537

PDB Hit:


Gene Protein Sequence:
MASSSNNSTKQDGIPSWVNPNVQWNRASQVGDQEANSLTPEAQTSRSWFS
DRKHFLEVLDVSLEEMENNDLKKYSRYKTIILIATLVTVAITCIVPISMV
FGIPMWVPCLILFGAGLSSAFLSHRLQSKCKEIHLRYRAYQIYRQQLLSQ
YPDLRKSTLYKYSITHVKPKKGFVGKLVENLRPDLHKNKDDGGAAADSRL
DFAGYGVKHYQTDALLGVSGVNSVEWQRLASLIMSVKNDILNDVGSREPI
DKAQRSALVVSGKDIGGEIQPGGILDISRDILAICGYGMNVGVEAKKAID
QYKKWYLNSSTFIAWNPQLPAIAQSYLLEQQRHLDYAAKIFQDLSALTTA
HGTGQALEDLDSLLCYYDQLIESKGVGEKIIASIHQKHLDLAMQDSCDQE
HLKKWSNLYHVFSITIKEFTEGKLEQNEVVSRIQRLRGKLEKSKCSILGN
CRTNAEYATKSEKKLADYLLQIGDREPFLTGMHKAIATGKAIQGKVEGVI
SQHPEKQIMMLRCSIERLEGMLRREDWGAILQKNEDEVLALKSTMEAQLQ
GFKDLVGTWEGKYQEFKKNKLSKVLVYDFTKSYSNLLNRLEVLHAESSTD
DLVLHVDRMSEDLKKTIEEIDGNLFQVTPEELSLLAREYQGLMNELPLIV
QEGNRLQEAISSEGVSQGLMLLNSLLNRDEKINKNIESSRKNLVAIAKQA
RSDARNIDSQGLAPLIQRNRASLDNILQNMYLFNGSIRNIHALDTETLVA
TSSNMFSAMHTFDWNIYTNLLDVLEIQSKPAPAPMENPDLPGALPEEVQD
AVAEDVSGTHRLHHQVLKRRCADLKNMISQLQKSINKWGMAKAIVLGIVA
VLFCVLSAIFIGQNILSLLILSCVGLLLTQVCPLIFDRISKSKEFEKQVL
ETAQSLIPATKILPSEFNNKDLNRLAKLQDNLNLEGFGPTWARNIVSDLE
GIPTKEKSLKDLTKEFRKDSKNLNKRIKRRFKEGLGQEAPVVRPTIPQDI
RGAEVFAELHRELEHLQKQKEEISIRGDALVQERMGLCLEKSKYDNEKAH
AAAMTKKVGKLQNIDRLQKNNETYVRIQNFFRTLIQEKLGRDTVQEIDVV
KEAKELHELAAIIYGNTSGKSQKQRAKKQFKENVLHIAGKGQLELLEAYL
NVTASQGLCRHQMQASFRERILLNPDGAKHGEAERTLASREEMLKTLGLS
YLTPFVRFSSPESTQSGYNQILKVREQLFDIEQRLQNQETVSPEDYAAVQ
AALAAYVRKHESLIVSTYGLGAQEGQTSSKVTTLMRDLHAVEELVEMGVE
TYRLNRSDQILHRVHSVLHSHLRDCDSSGNGIIDVVKKLFELLNNNGNNP
NDPECQKYMQILLDAPVSLLYGAFKSFKNEFLLNFTELNIANSTKAAEEE
AKRYVEEKGRGFETYWEEAKQRLEAIAAELDDLRNQETLLEQEIRLANLK
ISIFSDLNLREKVSVEKAALEEEIQGIQEQYAEMQGIEDLELKQKFEDLQ
KKLEALEERLLQIGRRIDSSVDKQKELLGLLGREEAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTTCTTCTTCAAACAATTCGACTAAACAGGACGGCATACCATCTTG
GGTAAACCCAAATGTCCAGTGGAATCGAGCGTCCCAGGTGGGTGATCAAG
AAGCGAATTCTCTAACTCCAGAGGCTCAAACTTCACGTAGCTGGTTTTCC
GATCGCAAGCATTTTCTTGAAGTCTTAGACGTTAGTCTAGAGGAGATGGA
GAACAATGACCTTAAGAAATACTCTAGATATAAGACGATTATCCTGATTG
CCACGCTGGTCACTGTTGCGATTACCTGTATCGTTCCTATCTCTATGGTG
TTTGGTATCCCGATGTGGGTGCCCTGTCTTATTTTATTTGGAGCGGGTCT
TTCTTCGGCTTTTCTTTCTCATCGTCTTCAATCTAAGTGCAAGGAGATCC
ATTTAAGATACCGAGCGTACCAGATTTATCGCCAGCAGCTGTTGAGTCAG
TACCCTGACTTGAGAAAGTCTACTCTCTATAAATATAGTATTACCCATGT
CAAACCGAAAAAGGGATTTGTTGGTAAACTCGTAGAAAATTTGCGCCCTG
ATTTGCATAAAAATAAGGACGATGGGGGTGCTGCTGCAGACTCCAGATTA
GATTTTGCGGGATATGGAGTAAAGCATTATCAGACGGATGCTCTACTTGG
AGTTTCAGGTGTTAATAGTGTAGAATGGCAACGTCTTGCCTCTCTGATTA
TGAGTGTTAAGAACGACATTTTAAATGATGTGGGAAGCAGAGAGCCCATT
GATAAAGCGCAAAGGTCTGCTTTAGTAGTCAGTGGTAAGGATATTGGAGG
GGAGATTCAGCCTGGAGGTATTTTAGATATTTCCAGAGATATTCTAGCGA
TCTGTGGCTACGGTATGAATGTAGGTGTTGAGGCGAAGAAAGCTATAGAC
CAGTATAAGAAGTGGTATCTCAATAGTAGTACATTTATTGCTTGGAATCC
GCAGCTTCCTGCTATTGCCCAGTCCTATTTACTAGAACAACAACGACATC
TAGATTATGCTGCTAAGATTTTCCAAGATCTTTCCGCATTGACGACAGCC
CATGGTACAGGGCAGGCTCTTGAAGATTTAGATAGTTTGCTTTGTTATTA
TGATCAGTTAATTGAATCTAAAGGTGTCGGTGAAAAGATAATAGCATCGA
TTCACCAGAAGCATCTCGACTTAGCAATGCAAGATTCCTGCGATCAGGAA
CATTTAAAGAAATGGTCGAATCTATACCACGTGTTTTCAATTACTATTAA
AGAATTCACTGAAGGTAAGCTAGAACAAAATGAGGTAGTATCTAGAATAC
AAAGGCTTCGAGGTAAGTTAGAAAAAAGTAAATGCAGCATTCTTGGAAAT
TGTCGAACCAACGCAGAATATGCAACAAAGTCTGAAAAAAAACTCGCAGA
TTATTTGCTGCAGATTGGGGATAGAGAACCTTTCCTTACTGGAATGCATA
AGGCGATAGCCACCGGAAAAGCTATTCAAGGAAAAGTGGAAGGAGTCATT
TCACAACATCCTGAAAAGCAAATTATGATGCTTCGGTGTTCTATAGAGAG
ACTCGAAGGGATGTTGCGTCGAGAGGATTGGGGAGCAATCCTACAAAAAA
ACGAAGACGAAGTCCTTGCATTGAAGAGTACAATGGAAGCTCAGCTTCAA
GGATTTAAGGACCTTGTAGGTACCTGGGAAGGAAAATATCAGGAATTTAA
GAAAAACAAGCTTTCCAAAGTTTTAGTTTACGACTTCACAAAATCCTATT
CTAACCTTCTAAATCGTTTGGAGGTACTCCATGCCGAGAGCTCCACGGAT
GATTTGGTATTACATGTCGATAGAATGTCGGAAGATCTGAAGAAAACAAT
CGAGGAGATTGACGGCAATTTATTTCAGGTAACTCCTGAAGAGCTCTCTT
TGTTAGCTCGGGAATATCAGGGACTCATGAATGAACTTCCTCTGATCGTT
CAAGAGGGGAATCGGCTCCAAGAAGCAATCTCTAGTGAAGGGGTTTCTCA
AGGATTGATGTTGTTGAACTCTTTATTGAATAGAGATGAAAAAATAAATA
AAAACATAGAAAGCAGTAGGAAAAACTTAGTAGCTATCGCGAAACAAGCA
CGTAGCGATGCGAGAAATATAGACAGTCAGGGATTGGCTCCTTTGATCCA
AAGGAATAGAGCTAGCCTGGACAACATTCTCCAGAATATGTATTTGTTTA
ACGGCAGTATACGTAATATCCATGCTCTAGATACGGAAACGTTAGTGGCA
ACTTCCTCTAATATGTTTTCTGCGATGCATACCTTCGACTGGAATATCTA
TACGAATTTGCTTGATGTTTTAGAAATCCAAAGCAAACCAGCTCCTGCCC
CTATGGAGAATCCTGACCTTCCTGGAGCTCTTCCTGAAGAGGTCCAGGAT
GCGGTTGCTGAAGATGTTTCTGGGACTCACAGGCTACATCACCAGGTGTT
AAAGAGACGCTGTGCTGACTTAAAAAATATGATCAGTCAATTGCAGAAGT
CGATAAACAAATGGGGAATGGCTAAGGCCATTGTCCTGGGAATTGTTGCG
GTGCTCTTCTGTGTTCTTAGTGCTATTTTTATTGGTCAGAACATTTTATC
CTTACTCATTCTCTCTTGTGTAGGGTTACTTTTGACTCAGGTATGTCCTT
TAATCTTTGATCGTATATCTAAGAGCAAGGAGTTTGAGAAGCAAGTGCTT
GAGACAGCGCAGTCCTTGATTCCTGCCACTAAGATTCTTCCCTCAGAATT
CAATAATAAGGATCTTAATCGTTTAGCTAAGCTCCAGGATAATTTAAATC
TTGAGGGTTTTGGTCCTACATGGGCGCGCAATATTGTGAGTGATCTAGAG
GGCATTCCGACTAAAGAAAAGAGCTTGAAGGATCTTACTAAAGAGTTCCG
TAAGGATTCTAAAAACTTAAATAAGCGTATAAAAAGACGTTTCAAGGAGG
GGTTAGGACAAGAAGCGCCTGTGGTTCGTCCTACTATCCCCCAAGATATT
CGTGGAGCTGAGGTTTTTGCAGAGTTACATCGCGAGTTAGAGCACCTTCA
AAAGCAAAAAGAAGAGATTAGTATTCGGGGAGATGCTCTGGTTCAAGAGC
GCATGGGTCTGTGCTTAGAAAAGTCTAAGTACGACAATGAAAAGGCTCAT
GCTGCCGCTATGACTAAGAAGGTTGGAAAATTACAAAACATAGATAGGCT
TCAAAAAAATAATGAAACGTATGTAAGGATTCAGAATTTTTTTAGAACTT
TGATTCAAGAGAAATTAGGGCGTGACACAGTCCAAGAGATAGACGTAGTC
AAAGAGGCTAAGGAATTACACGAATTAGCAGCAATCATTTACGGCAATAC
CAGTGGGAAATCTCAGAAGCAAAGAGCAAAAAAGCAGTTTAAAGAGAATG
TTTTACACATAGCAGGGAAGGGTCAATTAGAACTTTTAGAGGCTTACTTG
AATGTGACAGCTTCTCAAGGGCTCTGTCGCCATCAAATGCAGGCTTCATT
TAGAGAAAGAATCCTGCTAAATCCCGATGGAGCAAAACATGGAGAAGCCG
AGAGGACGCTTGCTTCTAGGGAAGAAATGTTGAAAACTCTAGGGCTTTCT
TATTTGACGCCTTTTGTAAGATTTTCTTCTCCAGAAAGTACGCAGTCTGG
ATATAACCAAATTCTGAAAGTCCGTGAGCAGCTCTTCGATATTGAGCAGA
GGCTTCAGAATCAGGAGACTGTGAGTCCCGAGGACTATGCGGCTGTACAA
GCTGCTTTAGCAGCTTATGTCCGCAAGCATGAATCTCTTATAGTTTCTAC
TTATGGATTGGGTGCTCAAGAAGGACAAACGAGTTCTAAAGTGACCACTT
TAATGCGAGATTTGCATGCTGTAGAAGAGCTTGTTGAGATGGGTGTCGAA
ACGTATCGATTGAATCGCAGCGATCAGATTCTGCATCGCGTGCATTCTGT
TTTACACAGCCATCTGCGAGATTGCGATTCTTCAGGAAATGGAATTATTG
ATGTAGTTAAGAAATTGTTTGAGCTTCTGAACAATAACGGGAACAATCCT
AATGATCCCGAATGCCAAAAGTATATGCAGATACTTTTAGATGCACCAGT
CAGTCTATTGTATGGTGCATTTAAAAGTTTCAAAAACGAATTTTTACTTA
ATTTCACGGAATTGAATATTGCTAATTCAACAAAAGCTGCTGAGGAAGAA
GCTAAAAGGTATGTTGAAGAGAAAGGTAGAGGTTTTGAGACTTATTGGGA
GGAGGCTAAGCAACGATTGGAAGCAATTGCTGCTGAGTTGGACGACTTAA
GGAATCAAGAGACTCTATTGGAACAAGAAATTCGTTTGGCGAATTTAAAG
ATAAGTATCTTTAGTGACTTAAATTTAAGAGAGAAGGTTTCAGTAGAAAA
AGCAGCTTTAGAAGAAGAAATCCAAGGAATACAAGAGCAATATGCAGAGA
TGCAGGGGATTGAAGATCTAGAGTTAAAACAAAAATTCGAAGATTTGCAA
AAGAAACTTGAAGCTCTAGAAGAAAGATTGTTGCAAATAGGTCGAAGGAT
AGATTCCTCTGTAGACAAGCAGAAAGAACTGTTGGGTCTCTTGGGTAGAG
AAGAGGCTGCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy