Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR122 IGR125 IGR123 IGR121 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 CPn0150 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0149

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnlJ  

Definition:
DNA ligase (NAD dependent

Gene Start:
185715

Gene Stop:
187703

Gene Length:
1989

Molecular Weight*:
73901

pI*:
6.30

Net Charge*:
-7.20

EC:
6.5.1.2  

Functional Class:
DNA metabolism  

Pathway: pathway table

Comment:
Responsible for phosphodiester linkages in
double-stranded DNA.

Blast Summary:  PSI-Blast Search
CPn0149 is similar to UU121 in U. urealyticum, MG254 in M. genitalium and TP0634 in T. pallidum. They are all predicted DNA ligases.

CPn0149 is orthologously related to CT146:
residues 6-659 are 60% similar to CT146.


COGS Summary:  COGS Search
BeTs to 12 clades of COG0272
COG name: NAD-dependent DNA ligase (contains BRCT domain type II)
Functional Class:  L
The phylogenetic pattern of COG0272 is -----qvcEbrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 4 to 314 (E-value = 1.1e-119) place CPn0149 in the DNA_ligase_aden family which is described as NAD-dependent DNA ligase adenylation domain (PF01653)
Residues 316 to 398 (E-value = 7.4e-52) place CPn0149 in the DNA_ligase_OB family which is described as NAD-dependent DNA ligase OB-fold domain (PF03120)
Residues 402 to 429 (E-value = 6.7e-12) place CPn0149 in the DNA_ligase_ZBD family which is described as NAD-dependent DNA ligase C4 zinc finger domain (PF03119)
Residues 529 to 558 (E-value = 1.2e-08) place CPn0149 in the HHH family which is described as Helix-hairpin-helix motif (PF00633)
Residues 583 to 659 (E-value = 4.7e-18) place CPn0149 in the BRCT family which is described as BRCA1 C Terminus (BRCT) domain (PF00533)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
371  
442

PDB Hit:


Gene Protein Sequence:
MKEENSQAHYLALCRELEDHDYSYYVLHRPRISDYEYDMKLRKLLEIERS
HPEWKVLWSPSTRLGDRPSGTFSVVSHKEPMLSIANSYSKEELSEFFSRV
EKSLGTSPRYTVELKIDGIAVAIRYEDRVLVQALSRGNGKQGEDITSNIR
TIRSLPLRLPEDAPEFIEVRGEVFFSYSTFQIINEKQQQLEKTIFANPRN
AAGGTLKLLSPQEVAKRKLEISIYNLIAPGDNDSHYENLQRCLEWGFPVS
GKPRLCSTPEEVISVLKTIETERASLPMEIDGAVIKVDSLASQRVLGATG
KHYRWALAYKYAPEEAETLLEDILVQVGRTGVLTPVAKLTPVLLSGSLVS
RASLYNEDEIHRKDIRIGDTVCVAKGGEVIPKVVRVCREKRPEGSEVWNM
PEFCPVCHSHVVREEDRVSVRCVNPECVAGAIEKIRFFVGRGALNIDHLG
VKVITKLFELGLVHTCADLFQLTTEDLMQIPGIRERSARNILESIEQAKH
VDLDRFLVALGIPLIGIGVATVLAGHFETLDRVISATFEELLSLEGIGEK
VAHAIAEYFSDSTHLNEIKKMQDLGVCISPYHKSGSTCFGKAFVITGTLE
GMSRLDAETAIRNCGGKVGSSVSKQTDYVVMGNNPGSKLEKARKLGVSIL
DQEAFTNLIHLE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGGAAGAGAATTCACAAGCACACTACTTAGCTTTATGTCGTGAATT
AGAAGACCATGATTATTCTTATTATGTGTTGCATCGTCCTAGAATCTCTG
ATTATGAATATGACATGAAATTACGGAAGCTTCTTGAAATAGAGAGAAGT
CATCCCGAATGGAAAGTCTTATGGTCTCCCTCAACACGTCTCGGAGATCG
TCCCTCTGGAACTTTTTCTGTGGTTTCCCATAAGGAACCGATGCTTTCCA
TTGCCAATAGCTATTCTAAAGAAGAACTAAGTGAGTTTTTTTCTAGGGTA
GAAAAATCCCTAGGTACAAGTCCACGTTATACAGTAGAACTTAAAATCGA
TGGGATTGCAGTAGCAATACGTTATGAAGATCGTGTGTTGGTTCAAGCAC
TCAGCCGAGGAAATGGAAAGCAGGGAGAGGATATCACATCGAATATTCGA
ACAATACGCTCCTTGCCTTTAAGACTTCCAGAAGATGCTCCAGAGTTTAT
TGAAGTACGTGGCGAGGTCTTCTTCTCTTATTCTACGTTTCAAATTATCA
ATGAGAAGCAGCAACAATTAGAGAAAACTATTTTTGCCAACCCGAGAAAT
GCTGCAGGAGGTACCTTAAAGTTACTTTCTCCTCAAGAAGTCGCAAAACG
TAAATTAGAAATTTCTATCTATAATCTCATTGCTCCAGGAGATAACGATT
CTCATTATGAAAATCTTCAGCGCTGCCTTGAATGGGGATTTCCTGTATCT
GGTAAACCAAGATTGTGCTCTACCCCAGAGGAAGTGATCTCAGTTTTAAA
GACTATAGAAACTGAGAGAGCTTCCTTGCCTATGGAAATCGATGGTGCTG
TCATCAAGGTAGACAGTTTGGCAAGTCAGAGAGTTCTTGGAGCCACAGGG
AAACACTATAGATGGGCCTTAGCTTATAAATATGCCCCAGAGGAAGCAGA
GACCCTTCTTGAGGATATTCTAGTTCAAGTAGGAAGAACGGGAGTTCTGA
CTCCTGTAGCTAAACTCACTCCTGTACTGTTGTCAGGGTCTTTAGTATCT
AGAGCGTCTCTATACAATGAAGATGAGATTCATAGAAAAGACATCCGTAT
TGGTGATACCGTTTGTGTTGCTAAAGGTGGAGAGGTGATTCCAAAAGTAG
TTCGGGTATGCAGAGAAAAACGTCCTGAAGGTTCTGAAGTTTGGAATATG
CCTGAATTCTGCCCTGTCTGCCATAGTCACGTAGTTCGGGAAGAAGATAG
AGTTTCTGTGCGTTGTGTCAATCCTGAGTGTGTTGCAGGAGCTATTGAAA
AAATTCGTTTTTTTGTTGGTCGGGGAGCTTTAAATATCGATCATTTAGGG
GTGAAGGTAATCACAAAGCTGTTTGAATTAGGGTTAGTGCACACGTGTGC
GGACCTATTTCAGCTGACTACTGAAGATTTAATGCAAATTCCCGGGATAC
GGGAACGCTCTGCAAGAAATATTCTAGAGAGTATCGAGCAAGCTAAACAT
GTGGATCTAGATCGTTTTCTTGTTGCTCTGGGGATTCCTCTCATTGGAAT
TGGTGTTGCTACTGTACTAGCTGGCCACTTCGAGACTTTAGATCGGGTAA
TTTCCGCGACTTTTGAAGAACTTCTTTCACTAGAGGGTATTGGAGAGAAG
GTGGCTCATGCTATTGCTGAGTATTTTTCAGACTCTACGCATCTTAACGA
AATCAAGAAAATGCAGGATTTAGGAGTGTGTATATCTCCTTATCATAAAT
CAGGATCTACGTGTTTTGGCAAGGCTTTTGTGATCACAGGGACGTTAGAG
GGAATGTCTCGGTTAGATGCAGAAACTGCTATCCGGAATTGTGGGGGTAA
GGTAGGCTCCTCTGTCTCGAAACAGACCGATTACGTAGTTATGGGGAATA
ACCCAGGATCTAAATTAGAGAAGGCTAGGAAATTGGGAGTCTCTATCTTA
GATCAAGAAGCCTTTACAAATCTAATTCATTTAGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy