Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR122 IGR125 IGR123 IGR120 IGR121 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0148

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pkn1  

Definition:
probable serine/threonine kinase

Gene Start:
183846

Gene Stop:
185705

Gene Length:
1860

Molecular Weight*:
70346

pI*:
4.80

Net Charge*:
-27.10

EC:
2.7.-.-  

Functional Class:
protein fate; protein modification and repair  

Pathway: pathway table

Comment:
See CT145. Designations are tentative, and based on CT145.
Note BLAST hits occur in two distinct areas; over the first 300 residues hits are varied, but include hits to serine/threonine protein kinases, whereas hits over last 250 residues are generally to hypothetical sequences.

Blast Summary:  PSI-Blast Search
Residues 378-615 are 37% similar to (D90901) hypothetical protein [Synechocystis sp.]; residues 381-614 are 29% similar to (Z84395) hypothetical protein Rv0712 [Mycobacterium tuberculosis]; residues 13-222 are 26% similar to PKN1_MYXXA; and residues 7-222 are 25% similar to (AJ132604) hypothetical protein [Lactococcus lactis].
CPn0148 is similar to CT145, a probable serine/threonine kinase: residues 4-618 are 58% similar to CT145.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0515
COG name: Serine/threonine protein kinases
Functional Class: T
The phylogenetic pattern of COG0515 is amtkYq-C-BR---gp-lIN-
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 430-561 are 39% similar to a defined domain of P72841_XXXXX, defined as: PROTEIN YFMG.
Residues 15-222 are 26% similar to a defined domain of PKN1_MYXXA, defined as: KINASE PROTEIN TRANSFERASE SERINE/THREONINE-PROTEIN ATP-BINDING RECEPTOR TYROSINE-PROTEIN PHOSPHORYLATION PRECURSOR CELL.


Paralogs:  Local Blast Search
Very weak evidence of paralogy to CPn0703: residues 12-224 are 18% similar to CPn0703.

Pfam Summary:  Pfam Search
Residues 381 to 616 (E-value = 2.4e-92) place CPn0148 in the DUF323 family which is described as Domain of unknown function (DUF323) (PF03781)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
297  
412

PDB Hit:


Gene Protein Sequence:
MESEKDIGAKFLGDYRILYRKGQSLWSEDLLAEHRFIKKRYLIRLLLPDL
GSSQPFMEAFHDVVVKLAKLNHPGILSIENVSESEGRCFLVTQEQDIPIL
SLTQYLKSIPRKLTELEIVDIVSQLASLLDYVHSEGLAQEEWNLDSVYIH
ILNGVPKVILPDLGFASLIKERILDGFISDEENRESKIKERVLLHTSEGK
QGREDTYAFGAITYYLLFGFLPQGIFPMPSKVFSDFIYDWDFLISSCLSC
FMEERAKELFPLIRKKTLGEELQNVVTNCIESSLREVPDPLESSQNLPQA
VLKVGETKVSHQQKESAEHLEFVLVEACSIDEAMDTAIESESSSGVEEEG
YSLALQSLLVREPVVSRYVEAEKEEPKPQPILTEMVLIEGGEFSRGSVEG
QRDELPVHKVILHSFFLDVHPVTNEQFIRYLECCGSEQDKYYNELIRLRD
SRIQRRSGRLVIEPGYAKHPVVGVTWYGASGYAEWIGKRLPTEAEWEIAA
SGGVAALRYPCGEEIEKSRANFFTADTTTVMSYPPNPYGLYDMAGNVYEW
CQDWYGYDFYEISAQEPESPQGPAQGVYRVLRGGCWKSLKDDLRCAHRHR
NNPGAVNSTYGFRCAKNIN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAGTGAGAAAGATATAGGAGCTAAGTTTTTAGGTGACTATAGGAT
TCTCTATCGCAAGGGGCAGAGCCTATGGAGCGAAGATCTTTTAGCCGAAC
ATCGATTTATAAAAAAACGTTACCTTATTCGATTACTTCTTCCTGATCTA
GGAAGTTCTCAACCATTCATGGAAGCTTTTCATGATGTTGTTGTTAAACT
AGCAAAATTAAACCATCCAGGCATCCTCAGTATAGAAAATGTTTCTGAAT
CTGAGGGAAGATGTTTCTTGGTAACACAAGAGCAAGACATCCCCATCCTT
TCACTAACGCAATATTTAAAAAGTATTCCCCGCAAACTTACAGAGCTAGA
AATTGTAGATATTGTAAGCCAACTCGCTTCTCTTTTAGATTATGTGCATT
CAGAAGGACTGGCTCAAGAAGAGTGGAATCTTGATTCTGTCTATATTCAT
ATTTTGAATGGTGTTCCTAAAGTCATACTCCCTGATCTGGGGTTTGCTTC
ATTGATAAAAGAACGTATTTTGGACGGGTTTATTTCAGATGAGGAGAATC
GAGAATCTAAAATAAAAGAAAGGGTACTACTTCACACTTCAGAAGGAAAA
CAAGGTAGAGAAGATACGTATGCTTTTGGTGCTATCACCTATTATTTACT
TTTTGGTTTTCTTCCTCAAGGCATTTTCCCTATGCCTTCGAAAGTTTTTT
CTGATTTTATCTATGATTGGGATTTTTTAATTAGCTCTTGTTTAAGTTGT
TTTATGGAAGAAAGGGCAAAAGAACTTTTCCCCTTAATAAGAAAAAAAAC
TTTAGGAGAAGAGCTGCAAAATGTTGTCACTAACTGTATAGAAAGCTCTT
TAAGGGAAGTGCCAGATCCTTTGGAATCTTCTCAGAATCTTCCTCAAGCG
GTCCTTAAAGTAGGGGAAACGAAGGTAAGTCACCAGCAGAAGGAATCTGC
GGAACATTTAGAATTTGTGTTAGTGGAAGCATGCTCCATAGATGAAGCCA
TGGATACCGCTATAGAATCCGAAAGTAGTTCTGGAGTTGAGGAGGAAGGG
TATTCCCTAGCTCTACAGTCTTTATTAGTTCGGGAACCAGTAGTGAGTCG
TTATGTAGAAGCTGAGAAAGAAGAACCCAAACCGCAACCCATACTTACAG
AAATGGTTTTAATAGAGGGAGGAGAATTCTCCCGAGGAAGTGTCGAAGGG
CAACGTGATGAGCTTCCTGTACATAAGGTAATTTTACATAGCTTTTTCTT
AGATGTTCATCCTGTGACGAACGAACAGTTTATTCGTTATTTAGAATGTT
GTGGTAGTGAACAGGATAAGTATTATAATGAGTTAATCCGATTGCGAGAT
TCTCGTATACAGCGTCGTTCGGGTAGGCTTGTTATAGAGCCAGGTTATGC
TAAGCACCCTGTCGTTGGGGTTACTTGGTATGGAGCCTCAGGGTATGCAG
AATGGATAGGAAAACGCCTGCCTACAGAAGCTGAATGGGAAATAGCTGCT
TCTGGCGGGGTGGCTGCGCTACGCTATCCCTGTGGGGAGGAAATCGAAAA
AAGCCGGGCAAATTTTTTCACTGCGGATACGACAACAGTCATGAGTTATC
CACCCAATCCTTATGGCCTCTATGATATGGCAGGGAATGTCTACGAGTGG
TGCCAAGATTGGTATGGGTATGATTTTTATGAAATTTCTGCTCAAGAGCC
AGAGAGTCCTCAAGGTCCTGCTCAAGGAGTCTATCGGGTGCTAAGAGGGG
GATGTTGGAAGAGCTTAAAAGATGATCTTCGCTGTGCTCATCGCCATCGT
AATAATCCTGGGGCTGTAAATAGTACGTATGGTTTTAGGTGCGCTAAAAA
TATCAATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy