Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR124 IGR122 IGR125 IGR123 IGR120 IGR121 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0146 CPn0145 pkn1, - CPn0148 dnlJ, - CPn0149 clpB, - CPn0144 CPn0150 CPn0147
* Calculated from Protein Sequence

Gene ID: CPn0147

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
183225

Gene Stop:
183674

Gene Length:
450

Molecular Weight*:
14727

pI*:
4.80

Net Charge*:
-2.20

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:
This protein sequence can be found under GenBank accession AAD18300.

Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST.
No significant similarity to C.trachomatis, T.pallidum, M.genitalium, or U.urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
43  
63
transmembrane  
68  
92
non-globular  
95  
149

PDB Hit:


Gene Protein Sequence:
MAVQSIKEAVTSAATSVGCVNCSREAIPAFNTEERATSIARSVIAAIIAV
VAISLLGLGLVVLAGCCPLGMAAGAITMLLGVALLAWAILITLRLLNIPK
AEIPSPGNNGEPNERNSATPPLEGGVAGEAGRGGGSPLTQLDLNSGAGS$


Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGTTCAATCTATAAAAGAAGCCGTAACATCAGCCGCAACATCAGT
AGGATGTGTAAACTGTTCTAGAGAGGCTATACCAGCATTTAATACAGAGG
AGAGAGCAACGAGTATTGCTAGATCTGTTATAGCAGCTATCATTGCTGTT
GTAGCTATCTCCTTACTCGGACTAGGTCTTGTAGTTCTTGCTGGTTGCTG
TCCTTTAGGAATGGCTGCGGGTGCTATAACAATGCTGCTGGGTGTAGCAT
TATTAGCTTGGGCAATACTGATTACTTTGAGACTGCTTAATATACCTAAG
GCTGAAATACCGAGTCCAGGGAACAACGGTGAGCCTAATGAAAGAAATTC
AGCAACTCCTCCTCTAGAGGGTGGTGTTGCAGGAGAAGCCGGTCGCGGCG
GGGGGTCACCTTTAACCCAACTTGATCTCAATTCAGGGGCGGGAAGTTAG



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy